Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody - BSA Free (NBP2-84038) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Gastrin-releasing Peptide/Bombesin/Neuromedin C. Peptide sequence: ENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKGSQREGRNPQLNQQ The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GRP |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody - BSA Free
Background
Gastrin-releasing peptide receptor (GRPR) is a Bombesin Receptor. In addition to its involvement in autism and mental retardation, GRPR may also play a role in the progression of cancer. Nicotine exposure induces an increase in GRPR expression in the lung Shriver et al. (2000). GRPR has been reported in brain, breast, colon, lung, lymph node, ovary, placenta, prostate, stomach, and uterus. It has also been shown to be expressed in several cancers, including those in breast, colon, lung, ovary, pancreas, and prostate.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Mu, Rt
Applications: ELISA, IHC
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Bt, Ca, Eq, Hu, Pm, Po, Pm, Rb
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P
Publications for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (NBP2-84038) (0)
There are no publications for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (NBP2-84038).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (NBP2-84038) (0)
There are no reviews for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (NBP2-84038).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (NBP2-84038) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Gastrin-releasing Peptide/Bombesin/Neuromedin C Products
Research Areas for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (NBP2-84038)
Find related products by research area.
|
Blogs on Gastrin-releasing Peptide/Bombesin/Neuromedin C