Gastrin Antibody - Azide and BSA Free

Western Blot: Gastrin Antibody - Azide and BSA Free [NBP3-02945] - Western blot analysis of lysates from mouse stomach, using Gastrin Rabbit pAb (A14571) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.

Product Discontinued

Gastrin Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Gastrin (NP_000796.1). MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GAST
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 11 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Gastrin Antibody - Azide and BSA Free

• G17
• GAS
• GAST
• Gastrin I
• gastrin
• Gastrin-17

Background

Gastrin, which is normally formed by mucosal cells in the gastric antrum and by the D cells of the pancreatic islets, is a hormone whose main function is to stimulate secretion of HCl by the gastric mucosa. HCl, in turn, inhibits gastrin formation. Gastrin also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine. Gastrin is regulated by epidermal growth factor in both mice and humans. Gastrin is excreted in excess by pancreatic tumors in the Zollinger- Ellison syndrome. Gastrin maps to human chromosome 17q-21. Gastrin- Releasing Peptide (GRP) stimulates the release of gastrin as well as other gastrointestinal hormones, in addition to acting as an autocrine growth factor for certain cell types. High levels of GRP are found in the human lung just after birth and levels decrease thereafter in parallel with the observed disease in a number of pulmonary neuroendocrine cells. GRP is known to promote lung tumorigenesis in model systems and, interestingly, is induced by retinoic acid. GRP is involved in several functions with the hypothalamus, and is thought to play a role in regulating pituitary hormone secretion. GRP maps to human chromosome 18q21.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: GAST