GAS2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GAS2 Antibody [NBP2-31733] - Staining of human cell line U-2 OS shows localization to nucleus, nucleoli and cytosol.

Immunohistochemistry-Paraffin: GAS2 Antibody [NBP2-31733] - Staining in human liver and pancreas tissues using anti-GAS2 antibody. Corresponding GAS2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: GAS2 Antibody [NBP2-31733] - Staining of human liver shows high expression.

Immunohistochemistry-Paraffin: GAS2 Antibody [NBP2-31733] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GAS2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GAS2 Antibody - BSA Free (NBP2-31733) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLKDMNPDNYLVVSASYKAKKEI
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GAS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GAS2 Protein (NBP2-31733PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GAS2 Antibody - BSA Free

• GAS-2
• growth arrest-specific 2
• growth arrest-specific protein 2
• MGC32610

Background

GAS2 is encoded by this gene is a caspase-3 substrate that plays a role in regulating microfilament and cell shape changes during apoptosis. It can also modulate cell susceptibility to p53-dependent apoptosis by inhibiting calpain activity. Two alternatively spliced transcript variants encoding the same protein have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GAS2
• Uniprot:
  • O43903(Human)