GAS2 Antibody (3H2W4)

Western Blot: GAS2 Antibody (3H2W4) [NBP3-33435] - Western blot analysis of lysates from Rat liver, using GAS2 Rabbit mAb at 1:900 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 3H2W4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

GAS2 Antibody (3H2W4) Summary

• Description: Novus Biologicals Rabbit GAS2 Antibody (3H2W4) (NBP3-33435) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human GAS2 (NP_005247.1).
  
  Sequence:
  MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKT
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: GAS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GAS2 Antibody (3H2W4)

• GAS-2
• growth arrest-specific 2
• growth arrest-specific protein 2
• MGC32610

Background

GAS2 is encoded by this gene is a caspase-3 substrate that plays a role in regulating microfilament and cell shape changes during apoptosis. It can also modulate cell susceptibility to p53-dependent apoptosis by inhibiting calpain activity. Two alternatively spliced transcript variants encoding the same protein have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GAS2