GALP Antibody - BSA Free

Immunohistochemistry-Paraffin: GALP Antibody [NBP2-84950] - Rabbit Anti-GALP antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adrenal. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x. Exposure Time: 0.5-2.0sec

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GALP Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence LLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMET The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GALP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GALP Antibody - BSA Free

• alarin
• galanin-like peptide
• gal-like peptide

Background

GALP is a galanin (GAL; MIM 137035)-like peptide that displays preferential binding and activation of galanin receptor-2 (GALR2; MIM 603691) (Ohtaki et al., 1999 [PubMed 10601261]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GALP Antibody (NBP2-84950)(1)

Publication using NBP2-84950

• Micali N, Ma S, Li M et al. Molecular programs of regional specification and neural stem cell fate progression in macaque telencephalon Science (New York, N.Y.) 2023-10-13 [PMID: 37824652] (ICC/IF, Human, Primate)
  
  Details:
  1:100 dilution

Bioinformatics

• Gene Symbol: GALP