GALP Antibody

Images

 
Immunohistochemistry-Paraffin: GALP Antibody [NBP2-84950] - Rabbit Anti-GALP antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adrenal. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GALP Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the following sequence LLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMET The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
GALP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GALP Antibody

  • alarin
  • galanin-like peptide
  • gal-like peptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33582
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp, Ze
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
DLP00
Species: Hu
Applications: ELISA
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-56929
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NBP2-33582
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
MAB6544
Species: Hu
Applications: CyTOF-ready, Flow, IHC
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NLS6168
Species: Hu, Pm, Pm
Applications: Flow (-), Flow, ICC/IF (-), ICC/IF, IHC, IHC-P, IP (-), IP, WB (-), WB
NBP2-16577
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-82693
Species: Hu
Applications: IHC, IHC-P, WB
MAB763
Species: Hu, Mu, Rt
Applications: IHC
NBP2-67843
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-47778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF497
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-80261
Applications: ELISA
NBP2-84950
Species: Hu
Applications: IHC, IHC-P

Publications for GALP Antibody (NBP2-84950) (0)

There are no publications for GALP Antibody (NBP2-84950).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GALP Antibody (NBP2-84950) (0)

There are no reviews for GALP Antibody (NBP2-84950). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GALP Antibody (NBP2-84950) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GALP Products

Bioinformatics Tool for GALP Antibody (NBP2-84950)

Discover related pathways, diseases and genes to GALP Antibody (NBP2-84950). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GALP Antibody (NBP2-84950)

Discover more about diseases related to GALP Antibody (NBP2-84950).
 

Pathways for GALP Antibody (NBP2-84950)

View related products by pathway.

PTMs for GALP Antibody (NBP2-84950)

Learn more about PTMs related to GALP Antibody (NBP2-84950).
 

Research Areas for GALP Antibody (NBP2-84950)

Find related products by research area.

Blogs on GALP

There are no specific blogs for GALP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GALP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GALP