Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody

Images

 
Immunohistochemistry: Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody [NBP2-49670] - Staining of human appendix shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids:YAKNNMWFDFGFDPNAQCEEGYVRARIAEVERRFRLVLIAEHLDESLVLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GAL3ST2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
Galactose-3-O-sulfotransferase 2/GAL3ST2 Recombinant Protein Antigen (NBP2-49670PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody

  • GAL3ST2
  • Galactose-3-O-sulfotransferase 2
  • GP3ST

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-62277
Species: Hu
Applications: WB
NBP1-85431
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24787
Species: Hu, Mu, Ca
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, Flow-CS, Flow-IC
NBP1-82309
Species: Hu
Applications: WB, IHC, IHC-P
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF5446
Species: Hu
Applications: WB, IP
NBP1-76514
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB5175
Species: Mu
Applications: WB, IHC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-204
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1219
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
MAB2038
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP2-49670
Species: Hu
Applications: IHC

Publications for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670) (0)

There are no publications for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670) (0)

There are no reviews for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Galactose-3-O-sulfotransferase 2/GAL3ST2 Products

Bioinformatics Tool for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670)

Discover related pathways, diseases and genes to Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670)

Discover more about diseases related to Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670).
 

Pathways for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670)

View related products by pathway.

PTMs for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670)

Learn more about PTMs related to Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670).

Blogs on Galactose-3-O-sulfotransferase 2/GAL3ST2

There are no specific blogs for Galactose-3-O-sulfotransferase 2/GAL3ST2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GAL3ST2
Entrez