Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody


Immunohistochemistry-Paraffin: Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody [NBP2-49670] - Staining of human liver shows low expression as expected.
Immunohistochemistry: Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody [NBP2-49670] - Staining of human appendix shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody [NBP2-49670] - Staining of human colon shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody [NBP2-49670] - Staining in human colon and liver tissues using anti-GAL3ST2 antibody. Corresponding GAL3ST2 more

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: YAKNNMWFDFGFDPNAQCEEGYVRARIAEVERRFRLVLIAEHLDESLVLL
Specificity of human Galactose-3-O-sulfotransferase 2/GAL3ST2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Galactose-3-O-sulfotransferase 2/GAL3ST2 Recombinant Protein Antigen (NBP2-49670PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody

  • GAL3ST2
  • Galactose-3-O-sulfotransferase 2
  • GP3ST


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca
Applications: WB, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Gp
Applications: IHC, IHC-P, IF
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu, Ca
Applications: IHC, IHC-Fr, IHC-P, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Flow, PEP-ELISA
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Rt
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670) (0)

There are no publications for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670) (0)

There are no reviews for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Galactose-3-O-sulfotransferase 2/GAL3ST2 Products

Bioinformatics Tool for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670)

Discover related pathways, diseases and genes to Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670)

Discover more about diseases related to Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670).

Pathways for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670)

View related products by pathway.

PTMs for Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670)

Learn more about PTMs related to Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody (NBP2-49670).

Blogs on Galactose-3-O-sulfotransferase 2/GAL3ST2

There are no specific blogs for Galactose-3-O-sulfotransferase 2/GAL3ST2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Galactose-3-O-sulfotransferase 2/GAL3ST2 Antibody and receive a gift card or discount.


Gene Symbol GAL3ST2