GAD1/GAD67 Antibody


Western Blot: GAD1/GAD67 Antibody [NBP2-58132] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunocytochemistry/ Immunofluorescence: GAD1/GAD67 Antibody [NBP2-58132] - Staining of human cell line A-431 shows localization to vesicles.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

GAD1/GAD67 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEVVDILLNYVRKTFDRS
Specificity of human GAD1/GAD67 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for GAD1/GAD67 Antibody

  • 67kD)
  • EC 4.1.1
  • FLJ45882
  • GAD1
  • GAD25
  • GAD67
  • glutamate decarboxylase 1 (brain, 67kDa)
  • Glutamate decarboxylase 67 kDa isoform


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ch, Gp, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P, IHC-FrFl
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GAD1/GAD67 Antibody (NBP2-58132) (0)

There are no publications for GAD1/GAD67 Antibody (NBP2-58132).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAD1/GAD67 Antibody (NBP2-58132) (0)

There are no reviews for GAD1/GAD67 Antibody (NBP2-58132). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GAD1/GAD67 Antibody (NBP2-58132) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional GAD1/GAD67 Products

Bioinformatics Tool for GAD1/GAD67 Antibody (NBP2-58132)

Discover related pathways, diseases and genes to GAD1/GAD67 Antibody (NBP2-58132). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAD1/GAD67 Antibody (NBP2-58132)

Discover more about diseases related to GAD1/GAD67 Antibody (NBP2-58132).

Pathways for GAD1/GAD67 Antibody (NBP2-58132)

View related products by pathway.

PTMs for GAD1/GAD67 Antibody (NBP2-58132)

Learn more about PTMs related to GAD1/GAD67 Antibody (NBP2-58132).

Research Areas for GAD1/GAD67 Antibody (NBP2-58132)

Find related products by research area.

Blogs on GAD1/GAD67

There are no specific blogs for GAD1/GAD67, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GAD1/GAD67 Antibody and receive a gift card or discount.


Gene Symbol GAD1