GABPB1 Antibody (7B5F5)

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 7B5F5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

GABPB1 Antibody (7B5F5) Summary

• Description: Novus Biologicals Rabbit GABPB1 Antibody (7B5F5) (NBP3-33509) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 290-395 of human GABPB1 (NP_005245.2).
  
  Sequence:
  TSGIGQPIIVTMPDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEAV
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: GABPB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for GABPB1 Antibody (7B5F5)

• E4TF1
• E4TF1-47
• E4TF1-53
• E4TF1BBABPB2
• GA binding protein transcription factor, beta subunit 1
• GA binding protein transcription factor, beta subunit 2
• GA-binding protein subunit beta-1
• GABP subunit beta-1
• GABPB-1
• GABPB2
• GABPB-2
• GABPBGABP subunit beta-2
• NRF2B1
• NRF2B2
• Nuclear respiratory factor 2
• Transcription factor E4TF1-47
• Transcription factor E4TF1-53

Background

GABPB1 encodes the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The encoded protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GABPB1