GABA-B R1 Antibody (2D7)

Images

 
Western Blot: GABA-B R1 Antibody (2D7) [H00002550-M01] - Analysis of GABBR1 expression in transfected 293T cell line by GABBR1 monoclonal antibody (M01), clone 2D7.Lane 1: GABBR1 transfected lysate(95 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: GABA-B R1 Antibody (2D7) [H00002550-M01] - Analysis of monoclonal antibody to GABBR1 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: GABA-B R1 Antibody (2D7) [H00002550-M01] - Analysis of GABBR1 over-expressed 293 cell line, cotransfected with GABBR1 Validated Chimera RNAi ( Cat # H00002550-R01V ) (Lane 2) or non-transfected control ...read more
Western Blot: GABA-B R1 Antibody (2D7) [H00002550-M01] - GABBR1 monoclonal antibody (M01), clone 2D7 Analysis of GABBR1 expression in IMR-32.
ELISA: GABA-B R1 Antibody (2D7) [H00002550-M01] - Detection limit for recombinant GST tagged GABBR1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, RNAi, S-ELISA
Clone
2D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GABA-B R1 Antibody (2D7) Summary

Immunogen
GABBR1 (AAH50532, 52 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG
Specificity
GABBR1 - gamma-aminobutyric acid (GABA) B receptor, 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GABBR1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • RNA Inhibition
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has also been used for IF, RNAi Validation and ELISA.
Publications
Read Publications using H00002550-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GABA-B R1 Antibody (2D7)

  • FLJ92613
  • GABA B R1
  • GABABR1
  • GABBR1
  • GABBR1-3
  • gamma-aminobutyric acid (GABA) B receptor, 1
  • gamma-aminobutyric acid type B receptor subunit 1
  • Gb1
  • GPRC3A
  • GPRC3Asubunit 1c
  • hGB1a
  • seven transmembrane helix receptor

Background

Gamma-aminobutyric acid (GABA) is the main inhibitory neurotransmitter in the mammalian central nervous system. GABA exerts its effects through ionotropic [GABA(A/C)] receptors, to produce fast synaptic inhibition, and metabotropic [GABA(B)] receptors, to produce slow, prolonged inhibitory signals. The GABA(B) receptor consists of a heterodimer of two related 7-transmembrane receptors, GABA(B) receptor 1 and GABA(B) receptor 2. The GABA(B) receptor 1 gene is mapped to chromosome 6p21.3 within the HLA class I region close to the HLA-F gene. Susceptibility loci for multiple sclerosis, epilepsy, and schizophrenia have also been mapped in this region. Alternative splicing of this gene generates 4 transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75496
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-44743
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
NB300-605
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
NBP1-59537
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46198
Species: Hu
Applications: WB, IHC
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NB100-64775
Species: Hu, Mu, Pm, Bv, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, CyTOF-ready, IHC-P (-)
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80061
Species: Hu
Applications: WB, IHC, IHC-P
NB100-65315
Species: Bv, Ca, Eq, Gt, Sh
Applications: Flow, IHC, IHC-Fr, IP
NB110-39033
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NLS418
Species: Hu
Applications: IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: IHC, IHC-P, ICC
NLS442
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
H00002550-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, RNAi, S-ELISA

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GABA-B R1 Antibody (H00002550-M01). (Showing 1 - 1 of 1 FAQs).

  1. Are there neutralizing peptides for this antibody?
    • There is no neutralizing peptide available for this antibody.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GABA-B R1 Products

Bioinformatics Tool for GABA-B R1 Antibody (H00002550-M01)

Discover related pathways, diseases and genes to GABA-B R1 Antibody (H00002550-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GABA-B R1 Antibody (H00002550-M01)

Discover more about diseases related to GABA-B R1 Antibody (H00002550-M01).
 

Pathways for GABA-B R1 Antibody (H00002550-M01)

View related products by pathway.

Research Areas for GABA-B R1 Antibody (H00002550-M01)

Find related products by research area.

Blogs on GABA-B R1

There are no specific blogs for GABA-B R1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GABA-B R1 Antibody (2D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol GABBR1
Entrez
OMIM
Uniprot