GABA-A R rho 2 Antibody Summary
Immunogen |
Synthetic peptide directed towards the middle region of human GABRR2 (NP_002034). Peptide sequence SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GABRR2 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1.0 ug/ml
|
Application Notes |
This is a rabbit polyclonal antibody against GABRR2 and was validated on Western blot. |
Theoretical MW |
54 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS & 2% Sucrose. |
Preservative |
0.09% Sodium Azide |
Purity |
Immunogen affinity purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for GABA-A R rho 2 Antibody
Background
GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. The protein encoded by this gene is a member of the rho subunit family and is a component of the GABA receptor complex. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Gt, Sh
Applications: Flow, IHC, IHC-Fr, IP
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, KD, WB
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for GABA-A R rho 2 Antibody (NBP1-80061) (0)
There are no publications for GABA-A R rho 2 Antibody (NBP1-80061).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GABA-A R rho 2 Antibody (NBP1-80061) (0)
There are no reviews for GABA-A R rho 2 Antibody (NBP1-80061).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GABA-A R rho 2 Antibody (NBP1-80061) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GABA-A R rho 2 Products
Bioinformatics Tool for GABA-A R rho 2 Antibody (NBP1-80061)
Discover related pathways, diseases and genes to GABA-A R rho 2 Antibody (NBP1-80061). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for GABA-A R rho 2 Antibody (NBP1-80061)
Discover more about diseases related to GABA-A R rho 2 Antibody (NBP1-80061).
| | Pathways for GABA-A R rho 2 Antibody (NBP1-80061)
View related products by pathway.
|
Research Areas for GABA-A R rho 2 Antibody (NBP1-80061)
Find related products by research area.
|
Blogs on GABA-A R rho 2