Novus Biologicals products are now on bio-techne.com

GABA-A R rho 2 Antibody

Images

 
Western Blot: GABA-A R rho 2 Antibody [NBP1-80061] - Sample Type: Human Fetal Brain Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: GABA-A R rho 2 Antibody [NBP1-80061] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Membrane(tight junctions - intercalated disks) Primary Antibody Concentration: ...read more
Western Blot: GABA-A R rho 2 Antibody [NBP1-80061] - Hela cell lysate, concentration 0.2-1 ug/ml.
Western Blot: GABA-A R rho 2 Antibody [NBP1-80061] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Western Blot: GABA-A R rho 2 Antibody [NBP1-80061] - Sample Type: 293T Antibody Dilution: 1.0 ug/ml GABRR2 is supported by BioGPS gene expression data to be expressed in HEK293T
Immunohistochemistry: GABA-A R rho 2 Antibody [NBP1-80061] - Human Adult heart Observed Staining: Membrane (tight junctions - intercalated disks) Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

GABA-A R rho 2 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the middle region of human GABRR2 (NP_002034). Peptide sequence SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GABRR2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for GABA-A R rho 2 Antibody

  • GABA A R rho 2
  • GABA(A) receptor subunit rho-2
  • GABAAR rho 2
  • GABAARr2
  • GABA-C R rho 2
  • GABA-C receptor, rho-2 subunit
  • GABRR2
  • gamma-aminobutyric acid (GABA) receptor, rho 2
  • gamma-aminobutyric acid receptor subunit rho-2

Background

GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. The protein encoded by this gene is a member of the rho subunit family and is a component of the GABA receptor complex. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
H00001421-M03
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP2-46198
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB100-65315
Species: Bv, Ca, Eq, Gt, Sh
Applications: Flow, IHC, IHC-Fr, IP
NBP3-25643
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
664-LI
Species: Hu
Applications: BA
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21792
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
H00002550-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, KD, WB
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-31661
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-21598
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP3-13166
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for GABA-A R rho 2 Antibody (NBP1-80061) (0)

There are no publications for GABA-A R rho 2 Antibody (NBP1-80061).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GABA-A R rho 2 Antibody (NBP1-80061) (0)

There are no reviews for GABA-A R rho 2 Antibody (NBP1-80061). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GABA-A R rho 2 Antibody (NBP1-80061) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GABA-A R rho 2 Products

Array NBP1-80061

Research Areas for GABA-A R rho 2 Antibody (NBP1-80061)

Find related products by research area.

Blogs on GABA-A R rho 2

There are no specific blogs for GABA-A R rho 2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GABA-A R rho 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GABRR2
Entrez
Uniprot