GABA-A R rho 2 Antibody - BSA Free

Western Blot: GABA-A R rho 2 Antibody [NBP1-80061] - Sample Type: Human Fetal Brain Antibody Dilution: 1.0 ug/ml

Immunohistochemistry: GABA-A R rho 2 Antibody [NBP1-80061] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Membrane(tight junctions - intercalated disks) Primary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec Protocol located in Reviews and Data.

Western Blot: GABA-A R rho 2 Antibody [NBP1-80061] - Hela cell lysate, concentration 0.2-1 ug/ml.

Western Blot: GABA-A R rho 2 Antibody [NBP1-80061] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml

Western Blot: GABA-A R rho 2 Antibody [NBP1-80061] - Sample Type: 293T Antibody Dilution: 1.0 ug/ml GABRR2 is supported by BioGPS gene expression data to be expressed in HEK293T

Immunohistochemistry: GABA-A R rho 2 Antibody [NBP1-80061] - Human Adult heart Observed Staining: Membrane (tight junctions - intercalated disks) Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 s

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GABA-A R rho 2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human GABRR2 (NP_002034). Peptide sequence SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GABRR2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 54 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GABA-A R rho 2 Antibody - BSA Free

• GABA A R rho 2
• GABA(A) receptor subunit rho-2
• GABAAR rho 2
• GABAARr2
• GABA-C R rho 2
• GABA-C receptor, rho-2 subunit
• GABRR2
• gamma-aminobutyric acid (GABA) receptor, rho 2
• gamma-aminobutyric acid receptor subunit rho-2

Background

GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. The protein encoded by this gene is a member of the rho subunit family and is a component of the GABA receptor complex. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GABRR2
• Entrez:
  • 2570(Human)
• Uniprot:
  • P28476()