GABA-A R pi Antibody - BSA Free

Western Blot: GABA-A R pi Antibody [NBP2-84036] - Host: Rabbit. Target: GABRP. Positive control (+): Human esophagus (ES). Negative control (-): Human stomach (ST). Antibody concentration: 1ug/ml

Immunohistochemistry: GABA-A R pi Antibody [NBP2-84036] - Human Intestine

Western Blot: GABA-A R pi Antibody [NBP2-84036] - Host: Rabbit. Target: GABRP. Positive control (+): Human esophagus (ES). Negative control (-): Human stomach (ST). Antibody concentration: 1ug/ml

Western Blot: GABA-A R pi Antibody [NBP2-84036] - Host: Rabbit. Target Name: GABRP. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml

Western Blot: GABA-A R pi Antibody [NBP2-84036] - Host: Rabbit. Target Name: GABRP. Sample Tissue: Human THP-1 Whole Cell. Antibody Dilution: 1ug/ml

Western Blot: GABA-A R pi Antibody [NBP2-84036] - Host: Rabbit. Target Name: GABRP. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GABA-A R pi Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GABA-A R pi. Peptide sequence: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GABRP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GABA-A R pi Antibody - BSA Free

• GABA A R pi
• GABA(A) receptor subunit pi
• GABAAR pi
• GABAARp
• GABRP
• gamma-aminobutyric acid (GABA) A receptor, pi
• gamma-aminobutyric acid receptor subunit pi
• MGC126386
• MGC126387

Background

The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitorysynaptic transmission in the central nervous system. The subunit encoded by this gene is expressed in severalnon-neuronal tissues including the uterus and ovaries. This subunit can assemble with known GABA A receptor subunits,and the presence of this subunit alters the sensitivity of recombinant receptors to modulatory agents such aspregnanolone. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GABRP