GABA-A R beta 1 Antibody (1Q3A9) Summary
| Description |
Novus Biologicals Rabbit GABA-A R beta 1 Antibody (1Q3A9) (NBP3-15857) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 350-450 of human GABA-A R beta 1 (NP_000803.2). EKNKLEMNKVQVDAHGNILLSTLEIRNETSGSEVLTSVSDPKATMYSYDSASIQYRKPLSSREAYGRALDRHGVPSKGRIRRRASQLKVKIPDLTDVNSID |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
GABRB1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for GABA-A R beta 1 Antibody (1Q3A9)
Background
GABA (A) receptors are ligand-gated chloride channels that play a role as inhibitory neurotransmitters. They are known targets for certain classes of environmental and pharmaceutical compounds because a number of drugs interact with binding sites on GABA (A). Some of these drugs include benzodiazepines, anticonvulsants, and anesthetics. GABA (A) Receptors are comprised of subunits and these are further classified into 3 major groups (alpha, beta, and gamma). The subunits determine the pharmacological characteristics.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Tr
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, KO, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Mu
Applications: Flow, IHC, Neut, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for GABA-A R beta 1 Antibody (NBP3-15857) (0)
There are no publications for GABA-A R beta 1 Antibody (NBP3-15857).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GABA-A R beta 1 Antibody (NBP3-15857) (0)
There are no reviews for GABA-A R beta 1 Antibody (NBP3-15857).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GABA-A R beta 1 Antibody (NBP3-15857) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GABA-A R beta 1 Products
Research Areas for GABA-A R beta 1 Antibody (NBP3-15857)
Find related products by research area.
|
Blogs on GABA-A R beta 1