G3BP2 Recombinant Protein Antigen

Images

 
There are currently no images for G3BP2 Protein (NBP1-82977PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

G3BP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human G3BP2.

Source: E. coli

Amino Acid Sequence: HNDMFRYEDEVFGDSEPELDEESEDEVEEEQEERQPSPEPVQENANSGYYEAHPVTNGIEEPLEESSHEPEPEPESETKTEELKPQVE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
G3BP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82977.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for G3BP2 Recombinant Protein Antigen

  • G3BP-2
  • GAP SH3 domain-binding protein 2
  • GTPase activating protein (SH3 domain) binding protein 2
  • KIAA0660
  • ras GTPase-activating protein-binding protein 2
  • Ras-GTPase activating protein SH3 domain-binding protein 2

Background

Ras-GAP SH3 domain binding protein (G3BP2) contains an RNA recognition motif (RRM) and an N-terminal nuclear transport factor 2-like (NTF2-like) domain. The G3BP family of proteins have been shown to function downstream of Ras and play a role in RNA metabolism, signal transduction, and proliferation.G3BP2 can interact with IkappaBalpha and IkappaBalpha/NFkappaB complexes. In this complex G3B2 is proposed to play a role in regulating the nucleocytoplasmic localization of NFkappaB as well as its activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010146-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
AF5094
Species: Hu, Mu, Rt
Applications: WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP1-84339
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-52813
Species: Hu, Rt
Applications: ICC/IF,  IHC-P, WB
H00004507-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
2914-HT
Species: Hu
Applications: BA
NB100-2176
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-88195
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
7754-BH/CF
Species: Hu
Applications: BA
NB200-191
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-21598
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF7550
Species: Hu
Applications: IP, KO, WB
NBP1-20863
Species: Hu
Applications: IHC,  IHC-P, IP, PEP-ELISA, WB
NBP2-45564
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF2000
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB

Publications for G3BP2 Protein (NBP1-82977PEP) (0)

There are no publications for G3BP2 Protein (NBP1-82977PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G3BP2 Protein (NBP1-82977PEP) (0)

There are no reviews for G3BP2 Protein (NBP1-82977PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for G3BP2 Protein (NBP1-82977PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional G3BP2 Products

Research Areas for G3BP2 Protein (NBP1-82977PEP)

Find related products by research area.

Blogs on G3BP2

There are no specific blogs for G3BP2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our G3BP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol G3BP2