G3BP1 Recombinant Protein Antigen

Images

 
There are currently no images for G3BP1 Protein (NBP1-83404PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

G3BP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human G3BP1.

Source: E. coli

Amino Acid Sequence: FRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
G3BP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83404.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for G3BP1 Recombinant Protein Antigen

  • ATP-dependent DNA helicase VIII
  • EC 3.6.1
  • EC 3.6.4.12
  • EC 3.6.4.13
  • G3BP-1
  • G3BPRas-GTPase-activating protein SH3-domain-binding protein
  • GAP binding protein
  • GAP SH3 domain-binding protein 1
  • GTPase activating protein (SH3 domain) binding protein 1
  • hDH VIII
  • HDH-VIII
  • MGC111040
  • ras GTPase-activating protein-binding protein 1
  • RasGAP-associated endoribonuclease G3BP

Background

G3BP1 encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46132
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF5094
Species: Hu, Mu, Rt
Applications: WB
NBP2-22238
Species: Hu, Mu
Applications: IP, WB
NBP1-82977
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-13509
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01452
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
NB120-6125
Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB
AF2226
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-25162
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
NBP1-82520
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46541
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-79932
Species: Hu, Ze
Applications: ICC/IF, ISH, WB
H00023435-M01
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-83210
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-268
Species: Hu, Po
Applications: IP, WB
NBP3-46699
Species: Hu, Mu
Applications: ELISA, WB
AF1457
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB

Publications for G3BP1 Protein (NBP1-83404PEP) (0)

There are no publications for G3BP1 Protein (NBP1-83404PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G3BP1 Protein (NBP1-83404PEP) (0)

There are no reviews for G3BP1 Protein (NBP1-83404PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for G3BP1 Protein (NBP1-83404PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional G3BP1 Products

Research Areas for G3BP1 Protein (NBP1-83404PEP)

Find related products by research area.

Blogs on G3BP1.

Understanding ‘Y’ in Breast Cancer: Crucial Role of DNA/RNA-binding Protein YB-1 in the Development, Pre-Invasive, and Metastatic Phases
Jamshed Arslan, Pharm D, PhD In the United States, 1 in 8 women will be diagnosed with breast cancer in her lifetime.1 Despite the prevalence, cancer genesis is a mystery. The heterogeneity of cancers makes it diff...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our G3BP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol G3BP1