G protein alpha Recombinant Protein Antigen

Images

 
There are currently no images for G protein alpha Protein (NBP1-89752PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

G protein alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GNAS.

Source: E. coli

Amino Acid Sequence: SGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLNPAFREAGAHGSYSPPPE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GNAS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89752.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for G protein alpha Recombinant Protein Antigen

  • Adenylate cyclase-stimulating G alpha protein
  • AHO
  • Alternative gene product encoded by XL-exon
  • Extra large alphas protein
  • GNAS complex locus
  • GNAS1GSA
  • GNASXL
  • GPSAC20orf45
  • GSP
  • guanine nucleotide binding protein (G protein), alpha stimulating activitypolypeptide 1
  • guanine nucleotide regulatory protein
  • guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
  • MGC33735
  • NESP
  • NESP55
  • neuroendocrine secretory protein
  • PHP1A
  • PHP1B
  • PHP1C
  • POH
  • protein ALEX
  • SCG6
  • secretogranin VI
  • XLalphas

Background

G protein alpha has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Some transcripts contains a differentially methylated region (DMR) at their 5' exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript is produced from an overlapping locus on the opposite strand. One of the transcripts produced from this locus, and the antisense transcript, are paternally expressed noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants encoding different isoforms have been found for this gene. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7665
Species: Hu
Applications: IHC, WB
NBP1-86713
Species: Hu
Applications: IHC,  IHC-P
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
MEP00B
Species: Mu
Applications: ELISA
NBP1-89296
Species: Hu
Applications: IHC,  IHC-P, WB
AF2569
Species: Hu
Applications: ICC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-92467
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP1-31528
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF2009
Species: Hu
Applications: ICC, IHC
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
AF1638
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NBP1-90927
Species: Hu
Applications: IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-89752PEP
Species: Hu
Applications: AC

Publications for G protein alpha Protein (NBP1-89752PEP) (0)

There are no publications for G protein alpha Protein (NBP1-89752PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G protein alpha Protein (NBP1-89752PEP) (0)

There are no reviews for G protein alpha Protein (NBP1-89752PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for G protein alpha Protein (NBP1-89752PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional G protein alpha Products

Research Areas for G protein alpha Protein (NBP1-89752PEP)

Find related products by research area.

Blogs on G protein alpha

There are no specific blogs for G protein alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our G protein alpha Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GNAS