Recombinant Mouse G-CSF Protein

Product Discontinued

Recombinant Mouse G-CSF Protein Summary

• Description: Csf3 (Mouse) Recombinant Protein
  
  Source: E. coli
  
  Amino Acid Sequence: MVPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
• Preparation Method: Escherichia coli expression system
• Details of Functionality: The activity is determined by the dose-dependent proliferation of mouse M-NFS-60 cells. The expected ED50 for this effect is 8-12 pg/mL.
• Protein/Peptide Type: Recombinant Protein
• Gene: CSF3

Applications/Dilutions

• Dilutions:
  • Functional
  • SDS-Page
• Application Notes: This product is useful for Func,SDS-PAGE.

Reactivity Notes

Mouse

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: No additive Reconstitute with sterilized water.
• Preservative: No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Mouse G-CSF Protein

• C17orf33
• chromosome 17 open reading frame 33
• colony stimulating factor 3 (granulocyte)
• CSF3
• CSF3OS
• Filgrastim
• GCSF
• G-CSF
• GCSFlenograstim
• granulocyte colony-stimulating factor
• Lenograstim
• MGC45931
• Pluripoietin

Background

Granulocyte Colony-Stimulating Factor (G-CSF , filgrastim, pegfilgrastim or lenograstim) is a hematopoietic growth factor that stimulates the proliferation and differentiation of hematopoietic progenitor cells committed to the neutrophil/granulocyte lineage, in a dose-dependent manner. It is produced by a variety of cells including macrophages, monocytes, fibroblasts, endothelial cells and bone marrow stroma in response to specific stimulation by f.ex. endotoxin, TNF-alpha and IFN-gamma. Clinical applications of G-CSF include treatment of leukopenia following cancer therapy and bone marrow transplantation. Human and murine G-CSF are cross-species reactive. Recombinant human G-CSF is a 18.7 kDa glycoprotein containing 174 amino acid residues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CSF3