FYB/ADAP/SLAP130 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RPFRVTGPNSSSGIQARKNLFNNQGNASPPAGPSNVPKFGSPKPPVAVKPSSEEKPDKEPKPPFLKPTGAGQRFGTPASLTTRDPEAKVGFLKPVGPKPINLPKEDSKPTFPWPPGNKPSLHSVNQD |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FYB1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for FYB/ADAP/SLAP130 Antibody - BSA Free
Background
FYB acts as an adapter protein of the FYN and LCP2 signaling cascades in T cells. Modulates the expression ofinterleukin-2 (IL-2). Involved in platelet activation. Prevents the degradation of SKAP1 and SKAP2
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Flow, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, IP
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Mu
Applications: CompCytotox, CyTOF-ready, Flow, ICC, IHC, IP, Tstim
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Publications for FYB/ADAP/SLAP130 Antibody (NBP1-91916) (0)
There are no publications for FYB/ADAP/SLAP130 Antibody (NBP1-91916).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FYB/ADAP/SLAP130 Antibody (NBP1-91916) (0)
There are no reviews for FYB/ADAP/SLAP130 Antibody (NBP1-91916).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for FYB/ADAP/SLAP130 Antibody (NBP1-91916) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FYB/ADAP/SLAP130 Products
Research Areas for FYB/ADAP/SLAP130 Antibody (NBP1-91916)
Find related products by research area.
|
Blogs on FYB/ADAP/SLAP130