Fucosyltransferase 8/FUT8 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Fucosyltransferase 8/FUT8 Antibody [NBP2-30689] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Fucosyltransferase 8/FUT8 Antibody [NBP2-30689] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Fucosyltransferase 8/FUT8 Antibody [NBP2-30689] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: Fucosyltransferase 8/FUT8 Antibody [NBP2-30689] - Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Fucosyltransferase 8/FUT8 Antibody [NBP2-30689] - Staining of human stomach shows strong granular cytoplasmic positivity in glandular cells.

Product Discontinued

Fucosyltransferase 8/FUT8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: WSGEVKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVIGVHVRRTD
• Predicted Species: Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FUT8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Fucosyltransferase 8/FUT8 Antibody - BSA Free

• alpha 1,6 Fucosyltransferase
• alpha-(1,6)-fucosyltransferase
• alpha1-6FucT
• EC 2.4.1.68
• fucosyltransferase 8 (alpha (1,6) fucosyltransferase)
• Fucosyltransferase 8
• FUT8
• GDP-fucose--glycoprotein fucosyltransferase
• GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase
• Glycoprotein 6-alpha-L-fucosyltransferase
• MGC26465

Background

FUT8 belongs to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternatively spliced variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FUT8
• Uniprot:
  • Q9BYC5()