Fucosyltransferase 8/FUT8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Fucosyltransferase 8/FUT8 Antibody [NBP2-30689] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry: Fucosyltransferase 8/FUT8 Antibody [NBP2-30689] - Staining of human salivary gland shows strong granular positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fucosyltransferase 8/FUT8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: WSGEVKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVIGVHVRRTD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FUT8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Fucosyltransferase 8/FUT8 Protein (NBP2-30689PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Fucosyltransferase 8/FUT8 Antibody

  • alpha 1,6 Fucosyltransferase
  • alpha-(1,6)-fucosyltransferase
  • alpha1-6FucT
  • EC 2.4.1.68
  • fucosyltransferase 8 (alpha (1,6) fucosyltransferase)
  • Fucosyltransferase 8
  • FUT8
  • GDP-fucose--glycoprotein fucosyltransferase
  • GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase
  • Glycoprotein 6-alpha-L-fucosyltransferase
  • MGC26465

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-83910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-27946
Species: Mu
Applications: B/N, Flow, IHC-Fr, IP
NBP1-83357
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38638
Species: Hu
Applications: WB, IHC, IHC-P
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP2-30689
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Fucosyltransferase 8/FUT8 Antibody (NBP2-30689) (0)

There are no publications for Fucosyltransferase 8/FUT8 Antibody (NBP2-30689).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fucosyltransferase 8/FUT8 Antibody (NBP2-30689) (0)

There are no reviews for Fucosyltransferase 8/FUT8 Antibody (NBP2-30689). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Fucosyltransferase 8/FUT8 Antibody (NBP2-30689) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fucosyltransferase 8/FUT8 Products

Bioinformatics Tool for Fucosyltransferase 8/FUT8 Antibody (NBP2-30689)

Discover related pathways, diseases and genes to Fucosyltransferase 8/FUT8 Antibody (NBP2-30689). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fucosyltransferase 8/FUT8 Antibody (NBP2-30689)

Discover more about diseases related to Fucosyltransferase 8/FUT8 Antibody (NBP2-30689).
 

Pathways for Fucosyltransferase 8/FUT8 Antibody (NBP2-30689)

View related products by pathway.

PTMs for Fucosyltransferase 8/FUT8 Antibody (NBP2-30689)

Learn more about PTMs related to Fucosyltransferase 8/FUT8 Antibody (NBP2-30689).

Blogs on Fucosyltransferase 8/FUT8

There are no specific blogs for Fucosyltransferase 8/FUT8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fucosyltransferase 8/FUT8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FUT8
Entrez
Uniprot