FTSJD2 Antibody

Images

 
Western Blot: FTSJD2 Antibody [NBP1-83048] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: FTSJD2 Antibody [NBP1-83048] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FTSJD2 Antibody [NBP1-83048] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts and leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FTSJD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GKPLVKDREAELLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENISAFRNFVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FTSJD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FTSJD2 Protein (NBP1-83048PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FTSJD2 Antibody

  • Cap1 2'O-ribose methyltransferase 1
  • cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
  • EC 2.1.1.57
  • FtsJ methyltransferase domain containing 2
  • FtsJ methyltransferase domain-containing protein 2
  • hMTr1
  • Interferon-stimulated gene 95 kDa protein
  • ISG95
  • KIAA0082FLJ22156
  • MTR1
  • S-adenosyl-L-methionine-dependent methyltransferase FTSJD2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30572
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86644
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4599
Species: Hu
Applications: WB, Simple Western, IHC, IP
NB100-56654
Species: Hu, Mu
Applications: WB, IHC-P
MAB4158
Species: Hu
Applications: IHC
NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-98867
Species: Rt
Applications: WB, IHC
NB100-65805
Species: Hu, Gt, Pm, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB110-74925
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85637
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-81601
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-48318
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85838
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-82018
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83048
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FTSJD2 Antibody (NBP1-83048) (0)

There are no publications for FTSJD2 Antibody (NBP1-83048).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FTSJD2 Antibody (NBP1-83048) (0)

There are no reviews for FTSJD2 Antibody (NBP1-83048). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FTSJD2 Antibody (NBP1-83048) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FTSJD2 Products

Bioinformatics Tool for FTSJD2 Antibody (NBP1-83048)

Discover related pathways, diseases and genes to FTSJD2 Antibody (NBP1-83048). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for FTSJD2 Antibody (NBP1-83048)

View related products by pathway.

PTMs for FTSJD2 Antibody (NBP1-83048)

Learn more about PTMs related to FTSJD2 Antibody (NBP1-83048).

Blogs on FTSJD2

There are no specific blogs for FTSJD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FTSJD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FTSJD2