FTSJD1 Antibody

Images

 
Western Blot: FTSJD1 Antibody [NBP1-70751] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FTSJD1 Antibody Summary

Immunogen
Synthetic peptides corresponding to FTSJD1 (FtsJ methyltransferase domain containing 1) The peptide sequence was selected from the middle region of FTSJD1. Peptide sequence LMYLLNCCFDQVHVFKPATSKAGNSEVYVVCLHYKGREAIHPLLSKMTLN.
Specificity
This antibody is specific for FTSJD1.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FTSJD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FTSJD1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FTSJD1 Antibody

  • adrift homolog
  • AFTftsJ methyltransferase domain-containing protein 1
  • EC 2.1.1
  • EC 2.1.1.-
  • FLJ11171
  • FtsJ methyltransferase domain containing 1
  • Protein adrift homolog

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-83046
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
AF2325
Species: Mu
Applications: WB, Neut
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NB120-15106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-76926
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-85699
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-14142
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-98594
Species: Hu
Applications: WB
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31354
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-70751
Species: Hu
Applications: WB

Publications for FTSJD1 Antibody (NBP1-70751) (0)

There are no publications for FTSJD1 Antibody (NBP1-70751).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FTSJD1 Antibody (NBP1-70751) (0)

There are no reviews for FTSJD1 Antibody (NBP1-70751). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FTSJD1 Antibody (NBP1-70751) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FTSJD1 Products

Bioinformatics Tool for FTSJD1 Antibody (NBP1-70751)

Discover related pathways, diseases and genes to FTSJD1 Antibody (NBP1-70751). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for FTSJD1 Antibody (NBP1-70751)

View related products by pathway.

PTMs for FTSJD1 Antibody (NBP1-70751)

Learn more about PTMs related to FTSJD1 Antibody (NBP1-70751).

Blogs on FTSJD1

There are no specific blogs for FTSJD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FTSJD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FTSJD1