Recombinant Human FSH beta GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human FSH beta Protein [H00002488-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human FSH beta GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 19-129 of Human FSH beta

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FSHB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.95 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FSH beta GST (N-Term) Protein

  • follicle stimulating hormone, beta polypeptide
  • Follicle-stimulating hormone beta subunit
  • Follitropin beta chain
  • follitropin subunit beta
  • Follitropin
  • follitropin, beta chain
  • FSH beta
  • FSHB
  • FSH-B
  • FSH-beta

Background

The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-38770
Species: Hu, Mu
Applications: WB
AF8016
Species: Hu
Applications: WB, IHC
NBP2-45298
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-34183
Species: Hu
Applications: IHC, IHC-P
338-AC/CF
Species: Hu, Mu, Rt
NB120-15160
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-90927
Species: Hu
Applications: WB, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
AF6380
Species: Mu
Applications: WB
H00005087-M01
Species: Hu, Mu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-88921
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1277
Species: Hu, Mu, Ma
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00002488-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for FSH beta Partial Recombinant Protein (H00002488-Q01) (0)

There are no publications for FSH beta Partial Recombinant Protein (H00002488-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FSH beta Partial Recombinant Protein (H00002488-Q01) (0)

There are no reviews for FSH beta Partial Recombinant Protein (H00002488-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FSH beta Partial Recombinant Protein (H00002488-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional FSH beta Products

Bioinformatics Tool for FSH beta Partial Recombinant Protein (H00002488-Q01)

Discover related pathways, diseases and genes to FSH beta Partial Recombinant Protein (H00002488-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FSH beta Partial Recombinant Protein (H00002488-Q01)

Discover more about diseases related to FSH beta Partial Recombinant Protein (H00002488-Q01).
 

Pathways for FSH beta Partial Recombinant Protein (H00002488-Q01)

View related products by pathway.

PTMs for FSH beta Partial Recombinant Protein (H00002488-Q01)

Learn more about PTMs related to FSH beta Partial Recombinant Protein (H00002488-Q01).

Blogs on FSH beta

There are no specific blogs for FSH beta, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FSH beta GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FSHB