FSD1L Antibody - BSA Free

Immunohistochemistry-Paraffin: FSD1L Antibody [NBP1-86583] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FSD1L Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MDSQKEALQRIISTLANKNDEIQNFIDTLHHTLKGVQENSSNILSELDEEFDSLYSILDEVKESMINCIKQEQA
• Predicted Species: Mouse (92%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FSD1L
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FSD1L Protein (NBP1-86583PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FSD1L Antibody - BSA Free

• CCDC10MGC45564
• Coiled-coil domain-containing protein 10
• CSDUFD1
• cystatin and DUF19 domain containing 1
• fibronectin type III and SPRY domain containing 1-like
• FSD1 C-terminal like
• FSD1 N-terminal like
• FSD1 N-terminal-like protein
• FSD1CL
• FSD1-like protein
• FSD1NLcoiled-coil domain containing 10
• MIR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FSD1L