Frizzled-7 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Frizzled-7 Antibody [NBP2-55952] - Staining of human cell line CACO-2 shows localization to nucleoplasm.

Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Frizzled-7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Frizzled-7 Antibody - BSA Free (NBP2-55952) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTAL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FZD7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: CC/IF, Fixation Permeabilization: Use PFA/Triton X-100. IHC-P, Retrieval method: HIER pH6.
• Control Peptide:

  Frizzled-7 Recombinant Protein Antigen (NBP2-55952PEP)

Reactivity Notes

Mouse 88%, Rat 88%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Frizzled-7 Antibody - BSA Free

• frizzled (Drosophila) homolog 7
• frizzled homolog 7 (Drosophila)
• Frizzled, drosophila, homolog of, 7
• Frizzled7
• Frizzled-7
• fz-7
• FZD7
• FzE3frizzled-7
• hFz7

Background

Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif. FZD7 gene expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FZD7