Frizzled-7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Frizzled-7 Antibody [NBP2-55952] - Staining of human cell line CACO-2 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Frizzled-7 Antibody [NBP2-55952] - Staining of human fallopian tube shows strong cytoplasmic positivity with a granular pattern in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Frizzled-7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTAL
Specificity
Specificity of human Frizzled-7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FZD7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Frizzled-7 Recombinant Protein Antigen (NBP2-55952PEP)

Reactivity Notes

Mouse 88%, Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Frizzled-7 Antibody

  • frizzled (Drosophila) homolog 7
  • frizzled homolog 7 (Drosophila)
  • Frizzled, drosophila, homolog of, 7
  • Frizzled7
  • Frizzled-7
  • fz-7
  • FZD7
  • FzE3frizzled-7
  • hFz7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB11201
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
AF1617
Species: Hu
Applications: WB
AF1329
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ChIP, CyTOF-ready, ICC, ICFlow
NLS5103
Species: Hu, Bv, Ca
Applications: IHC, IHC-P, ICC
NBP1-20920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-46367
Species: Hu
Applications: WB, IHC
AF1526
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
6129-FZ
Species: Hu
645-WN
Species: Hu, Mu
AF1001
Species: Mu
Applications: IHC
NBP2-23659
Species: Hu, Mu, Pm
Applications: WB
NBP2-24519
Species: Hu, Mu, Rt, Bv, Ca, Ch, Eq, Pm
Applications: WB
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF1329
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ChIP, CyTOF-ready, ICC, ICFlow
NBP1-89679
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-55952
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Frizzled-7 Antibody (NBP2-55952) (0)

There are no publications for Frizzled-7 Antibody (NBP2-55952).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Frizzled-7 Antibody (NBP2-55952) (0)

There are no reviews for Frizzled-7 Antibody (NBP2-55952). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Frizzled-7 Antibody (NBP2-55952) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Frizzled-7 Products

Bioinformatics Tool for Frizzled-7 Antibody (NBP2-55952)

Discover related pathways, diseases and genes to Frizzled-7 Antibody (NBP2-55952). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Frizzled-7 Antibody (NBP2-55952)

Discover more about diseases related to Frizzled-7 Antibody (NBP2-55952).
 

Pathways for Frizzled-7 Antibody (NBP2-55952)

View related products by pathway.

PTMs for Frizzled-7 Antibody (NBP2-55952)

Learn more about PTMs related to Frizzled-7 Antibody (NBP2-55952).
 

Research Areas for Frizzled-7 Antibody (NBP2-55952)

Find related products by research area.

Blogs on Frizzled-7

There are no specific blogs for Frizzled-7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Frizzled-7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FZD7