Frizzled-6 Antibody - BSA Free

Immunohistochemistry-Paraffin: Frizzled-6 Antibody [NBP1-89702] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: Frizzled-6 Antibody [NBP1-89702] - Staining of human placenta shows moderate cytoplasmic and membranous positivity in trophoblastic cells.

Staining of human Fallopian tube shows strong cytoplasmic and membranous positivity in glandular cells.

Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Frizzled-6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Frizzled-6 Antibody - BSA Free (NBP1-89702) is a polyclonal antibody validated for use in IHC and WB. Anti-Frizzled-6 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FZD6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Frizzled-6 Protein (NBP1-89702PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Frizzled-6 Antibody - BSA Free

• frizzled (Drosophila) homolog 6
• frizzled homolog 6 (Drosophila)
• Frizzled6
• Frizzled-6
• FZ6
• Fz-6
• FZD6
• Hfz6
• seven transmembrane helix receptor

Background

FZD6 is a Frizzled Receptor for Wnt signaling proteins involved in patterning during development. Contrary to other Frizzled proteins, FZD6 does not contain a C-terminal PDZ domain-binding motif. FZD6 is widely expressed. The Drosophila homolog activates Dishevelled. FZD6 expression has been reported in brain, colon, heart, kidney, liver, lung, ovary, pancreas, placenta, prostate, skeletal muscle, small intestine, testis, and thymus. Various tumor cell lines have also been shown to express FZD6. ESTs have been isolated from blood, brain, breast, connective tissue, liver, liver/spleen, lung, placenta, testis, thyroid, and vessel libraries. In addition, several ESTs have been isolated from tumor libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Frizzled-6 Antibody (NBP1-89702)(3)

Publications using NBP1-89702

• C Liu, M Zhang, X Yan, Y Ni, Y Gong, C Wang, X Zhang, L Wan, H Yang, C Ge, Y Li, W Zou, R Huang, X Li, B Sun, B Liu, J Yue, J Yu Single-cell dissection of cellular and molecular features underlying human cervical squamous cell carcinoma initiation and progression Science Advances, 2023-01-27;9(4):eadd8977. 2023-01-27 [PMID: 36706185] (Western Blot, Human)
• Catalano T, D'Amico E, Moscatello C et al. Oxidative Distress Induces Wnt/?-Catenin Pathway Modulation in Colorectal Cancer Cells: Perspectives on APC Retained Functions Cancers (Basel) 2021-11-30 [PMID: 34885156] (Western Blot, Human)
• Valnohova J, Kowalski-Jahn M, Sunahara RK, Schulte G. Functional dissection of the N-terminal extracellular domains of Frizzled 6 reveals their roles for receptor localization and Dishevelled recruitment. J. Biol. Chem. 2018-09-20 [PMID: 30237173] (WB, Human)

Bioinformatics

• Gene Symbol: FZD6
• Entrez:
  • 8323(Human)
• Uniprot:
  • O60353()