FRA2 Antibody

Images

 
Western Blot: FRA2 Antibody [H00002355-B01P] - Analysis of FOSL2 expression in transfected 293T cell line by FOSL2 polyclonal antibody. Lane 1: FOSL2 transfected lysate(35.20 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: FRA2 Antibody [H00002355-B01P] - Analysis of purified antibody to FOSL2 on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FRA2 Antibody Summary

Immunogen
FOSL2 (NP_005244.1, 1 a.a. - 326 a.a.) full-length human protein. MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FOSL2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FRA2 Antibody

  • FOS-like antigen 2
  • fos-related antigen 2
  • FRA-2
  • FRA2FLJ23306

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47757
Species: Hu
Applications: WB, IHC, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-85457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
H00002355-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for FRA2 Antibody (H00002355-B01P) (0)

There are no publications for FRA2 Antibody (H00002355-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FRA2 Antibody (H00002355-B01P) (0)

There are no reviews for FRA2 Antibody (H00002355-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FRA2 Antibody (H00002355-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FRA2 Products

Bioinformatics Tool for FRA2 Antibody (H00002355-B01P)

Discover related pathways, diseases and genes to FRA2 Antibody (H00002355-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FRA2 Antibody (H00002355-B01P)

Discover more about diseases related to FRA2 Antibody (H00002355-B01P).
 

Pathways for FRA2 Antibody (H00002355-B01P)

View related products by pathway.

PTMs for FRA2 Antibody (H00002355-B01P)

Learn more about PTMs related to FRA2 Antibody (H00002355-B01P).
 

Research Areas for FRA2 Antibody (H00002355-B01P)

Find related products by research area.

Blogs on FRA2

There are no specific blogs for FRA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FRA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOSL2
Uniprot