FPR1 Antibody - BSA Free

Immunohistochemistry-Paraffin: FPR1 Antibody [NBP2-47452] - Staining of human tonsil shows weak cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: FPR1 Antibody [NBP2-47452] - Staining of human colon tissue. Shows moderate cytoplasmic positivity in glandular cells and strong cytoplasmic positivity in peripheral leukocytes.

Immunohistochemistry-Paraffin: FPR1 Antibody [NBP2-47452] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: FPR1 Antibody [NBP2-47452] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FPR1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FPR1 Antibody - BSA Free (NBP2-47452) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-FPR1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FPR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID : 29057162)
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FPR1 Recombinant Protein Antigen (NBP2-47452PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29057162).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FPR1 Antibody - BSA Free

• fMet-Leu-Phe receptor
• fMLF-R
• fMLP receptor
• FMLP
• formyl peptide receptor 1
• FPR1
• FPRfMet-Leu-Phe receptor
• N-formyl peptide receptor
• N-formylpeptide chemoattractant receptor

Background

Official Gene Symbol: FPR1 Gen Bank Accession Number: NP_002020 Gene ID: 2357 (Human) Gene Map Locus: 19q13.4 (Human) FPR1 is a member of chemoattractant/chemokine GPCRs expressed mainly on leukocytes, neutrophils and monocytes. FPR1 is a seven transmembrane pertussis toxin-sensitive GPCR and binds to formylated peptides generated by bacteria resulting in leukocyte trafficking to the site of inflammation. Ligand binding to FPR results in activation of multiple effectors including phospholipase C leading to calcium mobilization and PKC activation. Other implications of FPR signaling include polarization of actin cytoskeletion, activation of various integrins, increased cell migration, phagocytosis, degranulation and release of reactive oxygen intermediates.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FPR1 Antibody (NBP2-47452)(1)

Publication using NBP2-47452

• Gardner PJ, Yazid S, Ribeiro J et al. Augmenting Endogenous Levels of Retinal Annexin A1 Suppresses Uveitis in Mice. Transl Vis Sci Technol. 2017-09-01 [PMID: 29057162] (ICC/IF, Mouse)

Review for FPR1 Antibody (NBP2-47452) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Khuynh Nguyen ICC Mouse 10/06/2023

Summary

• Application: Immunocytochemistry
• Sample Tested: Colon cancer
• Species: Mouse
• Lot: 000035128

Comments

• Comments: The antibody works well

Bioinformatics

• Gene Symbol: FPR1