Recombinant Human FOXQ1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human FOXQ1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 110-219 of Human FOXQ1

Source: Wheat Germ

Amino Acid Sequence: RSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHR

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FOXQ1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FOXQ1 Protein

  • forkhead box Q1
  • Hepatocyte nuclear factor 3 forkhead homolog 1
  • HFH-1
  • HFH1forkhead box protein Q1
  • HNF-3/forkhead-like protein 1
  • winged helix/forkhead transcription factor

Background

FOXQ1 - forkhead box Q1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1268
Species: Hu, Ze
Applications: WB, ChIP, Flow, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-87928
Species: Hu
Applications: IHC, IHC-P
AF2400
Species: Hu
Applications: WB, ChIP, ICC
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB100-1277
Species: Hu, Mu, Ft
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IF, IHC-WhMt
NBP2-16518
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55686
Species: Hu
Applications: ICC/IF
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002295-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
H00002300-D01P
Species: Hu
Applications: WB
AF4798
Species: Hu, Mu
Applications: WB
H00094234-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for FOXQ1 Partial Recombinant Protein (H00094234-Q01) (0)

There are no publications for FOXQ1 Partial Recombinant Protein (H00094234-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXQ1 Partial Recombinant Protein (H00094234-Q01) (0)

There are no reviews for FOXQ1 Partial Recombinant Protein (H00094234-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FOXQ1 Partial Recombinant Protein (H00094234-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for FOXQ1 Partial Recombinant Protein (H00094234-Q01)

Discover related pathways, diseases and genes to FOXQ1 Partial Recombinant Protein (H00094234-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOXQ1 Partial Recombinant Protein (H00094234-Q01)

Discover more about diseases related to FOXQ1 Partial Recombinant Protein (H00094234-Q01).
 

Pathways for FOXQ1 Partial Recombinant Protein (H00094234-Q01)

View related products by pathway.

PTMs for FOXQ1 Partial Recombinant Protein (H00094234-Q01)

Learn more about PTMs related to FOXQ1 Partial Recombinant Protein (H00094234-Q01).
 

Research Areas for FOXQ1 Partial Recombinant Protein (H00094234-Q01)

Find related products by research area.

Blogs on FOXQ1

There are no specific blogs for FOXQ1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FOXL2 Antibody
NB100-1277

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FOXQ1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXQ1