Novus Biologicals products are now on bio-techne.com

Recombinant Human FOXQ1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human FOXQ1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 110-219 of Human FOXQ1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FOXQ1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FOXQ1 GST (N-Term) Protein

  • forkhead box Q1
  • Hepatocyte nuclear factor 3 forkhead homolog 1
  • HFH-1
  • HFH1forkhead box protein Q1
  • HNF-3/forkhead-like protein 1
  • winged helix/forkhead transcription factor

Background

FOXQ1 - forkhead box Q1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1268
Species: Hu, Mu, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, KD, KO, PEP-ELISA, WB
AF3619
Species: Hu
Applications: ICC, Simple Western, WB
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
AF3975
Species: Hu
Applications: ICC, WB
NBP2-45269
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF6989
Species: Mu
Applications: IHC
NB100-1277
Species: Bv, Ma, Hu, Mu
Applications: ChIP, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
NBP2-16518
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-87461
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6988
Species: Hu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP3-25538
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-150
Species: Hu, Mu
Applications: ChIP, ICC/IF, IP, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
H00002300-M09
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF4798
Species: Hu
Applications: WB
H00094234-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for FOXQ1 Partial Recombinant Protein (H00094234-Q01) (0)

There are no publications for FOXQ1 Partial Recombinant Protein (H00094234-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXQ1 Partial Recombinant Protein (H00094234-Q01) (0)

There are no reviews for FOXQ1 Partial Recombinant Protein (H00094234-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FOXQ1 Partial Recombinant Protein (H00094234-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FOXQ1 Products

Research Areas for FOXQ1 Partial Recombinant Protein (H00094234-Q01)

Find related products by research area.

Blogs on FOXQ1

There are no specific blogs for FOXQ1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FOXQ1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXQ1