FoxP2 Recombinant Protein Antigen

Images

 
There are currently no images for FoxP2 Protein (NBP1-86671PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FoxP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FOXP2.

Source: E. coli

Amino Acid Sequence: AQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTSSNTSKASPPITHHS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FOXP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86671.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FoxP2 Recombinant Protein Antigen

  • CAG repeat protein 44
  • CAGH44
  • CAGH44TNRC10forkhead box protein P2
  • DKFZp686H1726
  • forkhead box P2
  • forkhead/winged-helix transcription factor
  • FoxP2
  • SPCH1
  • TNRC10
  • trinucleotide repeat containing 10
  • Trinucleotide repeat-containing gene 10 protein

Background

FOXP2 encodes an evolutionarily conserved transcription factor expressed in fetal and adult brain. This transcription factor is a member of the forkhead/winged-helix (FOX) family of transcription factors, and contains a FOX DNA-binding domain and a large polyglutamine tract. Members of the FOX family of transcription factors are regulators of embryogenesis. The product of this gene is thought to be required for proper development of speech and language regions of the brain during embryogenesis. Although a point mutation in this gene has been associated with the KE pedigree segregating developmental verbal dyspraxia, no association between mutations in this gene and another speech disorder, autism, has been found. Four alternative transcripts encoding three different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65125
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-39002
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
NBP1-88182
Species: Hu
Applications: IHC, IHC-P, WB
AF6854
Species: Hu
Applications: WB
NBP1-87201
Species: Hu
Applications: IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
NBP1-87076
Species: Hu
Applications: IHC, IHC-P, WB
NB100-2278
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-68766
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
AF8150
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
NBP2-50028
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB100-93472
Species: Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
AF3464
Species: Hu
Applications: IHC, WB
NBP1-77370
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB4218
Species: Hu
Applications: IHC, WB
7268-CT
Species: Hu
Applications: BA

Publications for FoxP2 Protein (NBP1-86671PEP) (0)

There are no publications for FoxP2 Protein (NBP1-86671PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxP2 Protein (NBP1-86671PEP) (0)

There are no reviews for FoxP2 Protein (NBP1-86671PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FoxP2 Protein (NBP1-86671PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FoxP2 Products

Blogs on FoxP2

There are no specific blogs for FoxP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FoxP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXP2