FoxP1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: FoxP1 Antibody [NBP1-89410] - Saining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: FoxP1 Antibody [NBP1-89410] - Staining of human rectum shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: FoxP1 Antibody [NBP1-89410] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: FoxP1 Antibody [NBP1-89410] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: FoxP1 Antibody [NBP1-89410] - Staining of human prostate shows weak nuclear positivity in glandular cells.

Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-FOXP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

ChIP-Exo-Seq composite graph for Anti-FOXP1 (NBP1-89410) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, ChIP, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FoxP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FoxP1 Antibody - BSA Free (NBP1-89410) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQLSVHTPKRESLSHEEHPHSHPLYGHGVCKWPGCEAVCEDFQSFLKHLNS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FOXP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FoxP1 Protein (NBP1-89410PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FoxP1 Antibody - BSA Free

• FLJ23741
• fork head-related protein like B
• forkhead box P1
• forkhead box protein P1
• FoxP1
• glutamine-rich factor 1
• hFKH1B
• HSPC215
• MGC12942
• MGC88572
• MGC99551
• QRF1
• QRF112CC4

Background

FOXP1 is a transcriptional repressor that plays an important role in the specification and differentiation of lung epithelium. The gene encoding this protein may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FOXP1