FOXL2 Antibody

Product Discontinued

FOXL2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to Foxl2 (forkhead box L2) The peptide sequence was selected from the C terminal of Foxl2. Peptide sequence SPATAAPPAPAPTSAPGLQFACARQPELAMMHCSYWDHDSKTGALHSRLD.
• Predicted Species: Human (100%), Mouse (100%), Porcine (100%), Bovine (100%), Rabbit (100%), Goat (100%), Equine (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FOXL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against Foxl2 and was validated on Western blot.
• Theoretical MW: 39 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FOXL2 Antibody

• BPES
• BPES1
• BPES1PINTO
• forkhead box L2
• forkhead box protein L2
• forkhead transcription factor FOXL2
• FOXL2
• PFRK
• PINTO
• POF3

Background

The function of Foxl2 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FOXL2
• Uniprot:
  • D4A0S1(Rat)