FOXL2 Antibody

Images

 
Western Blot: FOXL2 Antibody [NBP1-69031] - Titration: 0.2-1 ug/ml, Positive Control: Rat Liver.

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FOXL2 Antibody Summary

Immunogen
Synthetic peptides corresponding to Foxl2 (forkhead box L2) The peptide sequence was selected from the C terminal of Foxl2. Peptide sequence SPATAAPPAPAPTSAPGLQFACARQPELAMMHCSYWDHDSKTGALHSRLD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOXL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Foxl2 and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FOXL2 Antibody

  • BPES
  • BPES1PINTO
  • forkhead box L2
  • forkhead box protein L2
  • forkhead transcription factor FOXL2
  • PFRK
  • POF3

Background

The function of Foxl2 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
AF3075
Species: Hu
Applications: WB, ICC
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84071
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
AF475
Species: Mu
Applications: WB, IHC
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H7431-00
Species: Hu
Applications: WB
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for FOXL2 Antibody (NBP1-69031) (0)

There are no publications for FOXL2 Antibody (NBP1-69031).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXL2 Antibody (NBP1-69031) (0)

There are no reviews for FOXL2 Antibody (NBP1-69031). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FOXL2 Antibody (NBP1-69031) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FOXL2 Products

Bioinformatics Tool for FOXL2 Antibody (NBP1-69031)

Discover related pathways, diseases and genes to FOXL2 Antibody (NBP1-69031). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOXL2 Antibody (NBP1-69031)

Discover more about diseases related to FOXL2 Antibody (NBP1-69031).
 

Pathways for FOXL2 Antibody (NBP1-69031)

View related products by pathway.

PTMs for FOXL2 Antibody (NBP1-69031)

Learn more about PTMs related to FOXL2 Antibody (NBP1-69031).

Blogs on FOXL2

There are no specific blogs for FOXL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FOXL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXL2
Uniprot