FOXL1 Antibody (1A7) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
FOXL1 (NP_005241, 132 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFENGNYRRRKRKPKPGPGAPEAKRPRAETHQRSAEAQPEAGSGAGGSGPAISRLQAAPAGPSPLLDGPSPPAPLHWPGTASPNEDAGDAAQGAAAVAVGQAARTGDGP |
| Specificity |
FOXL1 (1A7) |
| Isotype |
IgG2b Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
FOXL1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for FOXL1 Antibody (1A7) - Azide and BSA Free
Background
FOXL1 is a 337 amino acid protein encoded by the mouse gene Foxl1. FOXL1 belongs to the fork head family and contains one fork head DNA-binding domain. The HNF3/fork head family includes a large number of transcription factors that share a structurally related DNA binding domain. Fork head factors are known to play important roles both during development and in adults. FOXL1 is a winged helix transcriptional regulator expressed in the mesenchymal layer of developing and mature gastrointestinal tract. FOXL1- deficient mice exhibit various defects not only in the epithelial layer of the gastrointestinal tract but also in gut-associated lymphoid tissues. In the small intestine of FOXL1-deficient mice, the formation of Peyer's patches is affected, particularly in the caudal region. FOXL1 is a mesenchymal modifier of the adenomatous polyposis coli (APC) gene products and plays a key role in gastrointestinal tumorigenesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC
Species: Mu
Applications: BA
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ChIP, ICC, IHC, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Publications for FOXL1 Antibody (H00002300-M03) (0)
There are no publications for FOXL1 Antibody (H00002300-M03).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FOXL1 Antibody (H00002300-M03) (0)
There are no reviews for FOXL1 Antibody (H00002300-M03).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FOXL1 Antibody (H00002300-M03) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FOXL1 Products
Blogs on FOXL1