FoxJ1/HFH4 Antibody (5B2) - Azide and BSA Free

Western Blot: FoxJ1/HFH4 Antibody (5B2) [H00002302-M01] - Detection against Immunogen (34.65 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 5B2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FoxJ1/HFH4 Antibody (5B2) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: FOXJ1 (NP_001445, 341 a.a. ~ 421 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAFL
• Specificity: FOXJ1 - forkhead box J1
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FOXJ1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FoxJ1/HFH4 Antibody (5B2) - Azide and BSA Free

• FKHL13
• FKHL13forkhead transcription factor HFH-4
• forkhead box J1
• forkhead-like 13
• Forkhead-related protein FKHL13
• FoxJ1
• Hepatocyte nuclear factor 3 forkhead homolog 4
• HFH-4
• HFH4fork head homologue 4
• HFH-4forkhead box protein J1
• MGC35202

Background

FOXJ1 is a member of the forkhead gene family, which was originally identified in Drosophila. The forkhead family is composed of transcription factors with a conserved 100-amino acid DNA-binding motif.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FOXJ1
• Entrez:
  • 2302(Human)
• OMIM:
  • 602291(Human)
• Uniprot:
  • NP_001445(Human)