FoxJ1/HFH4 Antibody (5B2) - Azide and BSA Free Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
FOXJ1 (NP_001445, 341 a.a. ~ 421 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAFL |
Specificity |
FOXJ1 - forkhead box J1 |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
FOXJ1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for FoxJ1/HFH4 Antibody (5B2) - Azide and BSA Free
Background
FOXJ1 is a member of the forkhead gene family, which was originally identified in Drosophila. The forkhead family is composed of transcription factors with a conserved 100-amino acid DNA-binding motif.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ChIP, ICC, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu
Applications: ICC, WB
Species: Mu
Applications: BA
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB, ELISA
Publications for FoxJ1/HFH4 Antibody (H00002302-M01) (0)
There are no publications for FoxJ1/HFH4 Antibody (H00002302-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FoxJ1/HFH4 Antibody (H00002302-M01) (0)
There are no reviews for FoxJ1/HFH4 Antibody (H00002302-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FoxJ1/HFH4 Antibody (H00002302-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FoxJ1/HFH4 Products
Research Areas for FoxJ1/HFH4 Antibody (H00002302-M01)
Find related products by research area.
|
Blogs on FoxJ1/HFH4