FOXI1 Antibody - BSA Free

Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660] - Analysis in human kidney and liver tissues. Corresponding FOXI1 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: FOXI1 Antibody [NBP2-49660] - Staining of human cell line U-2 OS shows localization to nucleoli & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660] - Staining of human cerebellum shows no positivity in Purkinje cells as expected.

Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660] - Staining of human kidney shows moderate nuclear positivity in a subset of cells in tubules.

Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660] - Staining of human salivary gland shows moderate nuclear positivity in a subset of glandular cells.

Immunohistochemistry-Paraffin: FOXI1 Antibody [NBP2-49660] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FOXI1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FOXI1 Antibody - BSA Free (NBP2-49660) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TSHPLVTPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHFYNSVNTSG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FOXI1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FOXI1 Recombinant Protein Antigen (NBP2-49660PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FOXI1 Antibody - BSA Free

• FKHL10HFH3
• forkhead box I1
• forkhead box protein I1
• forkhead-like 10
• forkhead-related activator 6
• Forkhead-related protein FKHL10
• Forkhead-related transcription factor 6
• FREAC-6
• FREAC6FKH10
• Hepatocyte nuclear factor 3 forkhead homolog 3
• HFH-3
• HNF-3/fork-head homolog 3
• HNF-3/fork-head homolog-3
• MGC34197

Background

FOXI1 belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it is possible that this gene plays an important role in the development of the cochlea and vestibulum, as well as embryogenesis. Mutations in this gene may be associated with the common cavity phenotype. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FOXI1