Recombinant Human FOXG1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human FOXG1 Protein [H00002290-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human FOXG1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 183-291 of Human FOXG1B

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGAR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
FOXG1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FOXG1 GST (N-Term) Protein

  • BF-1
  • BF1HBF-2
  • BF2
  • BF-2
  • Brain factor 1
  • Brain factor 2
  • FHKL3
  • FKHL1forkhead-like 1
  • FKHL2
  • FKHL3
  • FKHL4
  • forkhead box G1
  • forkhead box G1A
  • forkhead box G1B
  • forkhead box G1C
  • Forkhead box protein G1A
  • Forkhead box protein G1B
  • Forkhead box protein G1C
  • forkhead-like 3
  • forkhead-like 4
  • Forkhead-related protein FKHL1
  • Forkhead-related protein FKHL2
  • Forkhead-related protein FKHL3
  • FOXG1A
  • FOXG1Bforkhead-like 2
  • FOXG1C
  • HBF-1
  • hBF-2
  • HBF-3
  • HFK1HBF-G2
  • HFK2HBF2
  • HFK3KHL2
  • oncogene QIN
  • QINFKH2forkhead box protein G1

Background

Transcription repression factor which plays an important role in the establishment of the regional subdivision of the developing brain and in the development of the telencephalon. This gene participates in signal transduction Activin A signaling regulation, TGF-beta receptor signaling pathway, transcription factors in neurogenesis, as well as regulation of nuclear SMAD2/3 signaling. It is thought to interact with genes FOXO1, FOXO3, FOXO4, SMAD2, and SMAD3. FOXG1 is associated with diseases such as melanoma, neuronitis, glioblastoma, purpura, west syndrome, rett syndrome, medulloblastoma, hypotonia, retinitis, maternal uniparental disomy, chromosome 14, intellectual disabilities, brain malformations, multiple sclerosis, and lupus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56326
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-31376
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
423-F8
Species: Hu, Mu
Applications: BA
NBP1-89985
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
NB300-925
Species: Hu
Applications: ICC/IF, PEP-ELISA
NBP1-84881
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
314-BP
Species: Hu
Applications: BA, BA
AF8150
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF,  IHC-P, IP, PA, WB
NBP2-46175
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1148
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
AF3975
Species: Hu
Applications: ICC, WB
AF1979
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-30951
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-16521
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, WB
H00002290-Q01
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for FOXG1 Partial Recombinant Protein (H00002290-Q01) (0)

There are no publications for FOXG1 Partial Recombinant Protein (H00002290-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXG1 Partial Recombinant Protein (H00002290-Q01) (0)

There are no reviews for FOXG1 Partial Recombinant Protein (H00002290-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FOXG1 Partial Recombinant Protein (H00002290-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FOXG1 Products

Research Areas for FOXG1 Partial Recombinant Protein (H00002290-Q01)

Find related products by research area.

Blogs on FOXG1.

Deriving neural precursor cells from human induced pluripotent stem cells
By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FOXG1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXG1