Recombinant Human FOXG1 GST (N-Term) Protein

SDS-Page: Recombinant Human FOXG1 Protein [H00002290-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, PAGE, AP

Recombinant Human FOXG1 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 183-291 of Human FOXG1B
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: PFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGAR

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: FOXG1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 37.73 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FOXG1 GST (N-Term) Protein

• BF-1
• BF1HBF-2
• BF2
• BF-2
• Brain factor 1
• Brain factor 2
• FHKL3
• FKHL1forkhead-like 1
• FKHL2
• FKHL3
• FKHL4
• forkhead box G1
• forkhead box G1A
• forkhead box G1B
• forkhead box G1C
• Forkhead box protein G1A
• Forkhead box protein G1B
• Forkhead box protein G1C
• forkhead-like 3
• forkhead-like 4
• Forkhead-related protein FKHL1
• Forkhead-related protein FKHL2
• Forkhead-related protein FKHL3
• FOXG1A
• FOXG1Bforkhead-like 2
• FOXG1C
• HBF-1
• hBF-2
• HBF-3
• HFK1HBF-G2
• HFK2HBF2
• HFK3KHL2
• oncogene QIN
• QINFKH2forkhead box protein G1

Background

Transcription repression factor which plays an important role in the establishment of the regional subdivision of the developing brain and in the development of the telencephalon. This gene participates in signal transduction Activin A signaling regulation, TGF-beta receptor signaling pathway, transcription factors in neurogenesis, as well as regulation of nuclear SMAD2/3 signaling. It is thought to interact with genes FOXO1, FOXO3, FOXO4, SMAD2, and SMAD3. FOXG1 is associated with diseases such as melanoma, neuronitis, glioblastoma, purpura, west syndrome, rett syndrome, medulloblastoma, hypotonia, retinitis, maternal uniparental disomy, chromosome 14, intellectual disabilities, brain malformations, multiple sclerosis, and lupus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: FOXG1