CDKL5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CDKL5 Antibody [NBP1-84881] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: CDKL5 Antibody [NBP1-84881] - Staining of human colon shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDKL5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AARANSLQLLSPQPGEQLPPEMTVARSSVKETSREGTSSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYNDPVPRRVGSFYRVPSPRPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDKL5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CDKL5 Protein (NBP1-84881PEP)
Publications
Read Publication using NBP1-84881.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDKL5 Antibody

  • cyclin-dependent kinase-like 5
  • serine/threonine kinase 9
  • serine/threonine-protein kinase 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF7068
Species: Hu
Applications: WB, IHC, ICC
NB120-22104
Species: Hu, Mu, Rt
Applications: WB
NBP1-56594
Species: Hu
Applications: WB, IHC, IHC-P
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB8626
Species: Hu
Applications: Flow, CyTOF-ready
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF1166
Species: Mu
Applications: WB
NBP2-58876
Species: Hu
Applications: ICC/IF
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
MAB27441
Species: Mu
Applications: WB, IHC
NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
NB500-240
Species: Hu, Mu
Applications: WB, IP
H00055777-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-60052
Species: Hu
Applications: WB
NBP1-84880
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87257
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84881
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for CDKL5 Antibody (NBP1-84881)(1)

Reviews for CDKL5 Antibody (NBP1-84881) (0)

There are no reviews for CDKL5 Antibody (NBP1-84881). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CDKL5 Antibody (NBP1-84881) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDKL5 Products

Bioinformatics Tool for CDKL5 Antibody (NBP1-84881)

Discover related pathways, diseases and genes to CDKL5 Antibody (NBP1-84881). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDKL5 Antibody (NBP1-84881)

Discover more about diseases related to CDKL5 Antibody (NBP1-84881).
 

Pathways for CDKL5 Antibody (NBP1-84881)

View related products by pathway.

PTMs for CDKL5 Antibody (NBP1-84881)

Learn more about PTMs related to CDKL5 Antibody (NBP1-84881).
 

Research Areas for CDKL5 Antibody (NBP1-84881)

Find related products by research area.

Blogs on CDKL5

There are no specific blogs for CDKL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDKL5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDKL5