FoxF1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: FoxF1 Antibody [NBP1-84670] - Staining of human cell line BJ shows localization to nucleoplasm. Antibody staining is shown in green.

Analysis in human lung tissue.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FoxF1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FoxF1 Antibody - BSA Free (NBP1-84670) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-FoxF1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GFRRKCQALKPMYSMMNGLGFNHLPDTYGFQGSAGGLSCPPNSLALEGGLGMMNGHLPGNVDGMALPSHSVPHLPSNGGHSYMGG
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FOXF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  FoxF1 Protein (NBP1-84670PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FoxF1 Antibody - BSA Free

• FKHL5
• FKHL5MGC105125
• forkhead box F1
• forkhead box protein F1
• Forkhead, drosophila, homolog-like 5
• Forkhead-related activator 1
• Forkhead-related protein FKHL5
• Forkhead-related transcription factor 1
• FoxF1
• FREAC-1
• FREAC1ACDMPV

Background

FOXF1 belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the regulation of pulmonary genes as well as embryonic development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FoxF1 Antibody (NBP1-84670)(1)

Publication using NBP1-84670

• Lo PK, Lee JS, Sukumar S et al. The p53-p21WAF1 checkpoint pathway plays a protective role in preventing DNA rereplication induced by abrogation of FOXF1 function. Cell Signal 2012-01-01 [PMID: 21964066]

Bioinformatics

• Gene Symbol: FOXF1