FoxF1 Antibody

Images

 
Western Blot: FoxF1 Antibody [NBP1-84670] - Analysis in human lung tissue.
Immunocytochemistry/ Immunofluorescence: FoxF1 Antibody [NBP1-84670] - Staining of human cell line BJ shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FoxF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GFRRKCQALKPMYSMMNGLGFNHLPDTYGFQGSAGGLSCPPNSLALEGGLGMMNGHLPGNVDGMALPSHSVPHLPSNGGHSYMGG
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOXF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF, Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
FoxF1 Protein (NBP1-84670PEP)
Publications
Read Publication using NBP1-84670.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FoxF1 Antibody

  • FKHL5
  • FKHL5MGC105125
  • forkhead box F1
  • forkhead box protein F1
  • Forkhead, drosophila, homolog-like 5
  • Forkhead-related activator 1
  • Forkhead-related protein FKHL5
  • Forkhead-related transcription factor 1
  • FoxF1
  • FREAC-1
  • FREAC1ACDMPV

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
H00002295-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF2400
Species: Hu
Applications: WB, IHC, ChIP, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NB600-600
Species: Hu, Mu, Ca
Applications: WB, ChIP, ELISA, Flow, IB, IHC, IHC-P, Flow-IC, KD
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, PEP-ELISA
H00002300-M09
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00010210-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1268
Species: Hu, Mu, Ze
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, KD, KO
NBP1-59443
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF3628
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NB300-925
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA

Publications for FoxF1 Antibody (NBP1-84670)(1)

Reviews for FoxF1 Antibody (NBP1-84670) (0)

There are no reviews for FoxF1 Antibody (NBP1-84670). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FoxF1 Antibody (NBP1-84670) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FoxF1 Products

Bioinformatics Tool for FoxF1 Antibody (NBP1-84670)

Discover related pathways, diseases and genes to FoxF1 Antibody (NBP1-84670). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxF1 Antibody (NBP1-84670)

Discover more about diseases related to FoxF1 Antibody (NBP1-84670).
 

Pathways for FoxF1 Antibody (NBP1-84670)

View related products by pathway.

PTMs for FoxF1 Antibody (NBP1-84670)

Learn more about PTMs related to FoxF1 Antibody (NBP1-84670).

Blogs on FoxF1

There are no specific blogs for FoxF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FoxF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXF1