FoxC2 Antibody (3E6)

Images

 
Western Blot: FoxC2 Antibody (3E6) [H00002303-M08] - Analysis of FOXC2 expression in Jurkat (Cat # L017V1).
Western Blot: FoxC2 Antibody (3E6) [H00002303-M08] - Analysis of FOXC2 expression in PC-12 (Cat # L012V1).
Sandwich ELISA: FoxC2 Antibody (3E6) [H00002303-M08] - Detection limit for recombinant GST tagged FOXC2 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3E6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FoxC2 Antibody (3E6) Summary

Immunogen
FOXC2 (NP_005242, 156 a.a. ~ 256 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSL
Specificity
FOXC2 (3E6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FOXC2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FoxC2 Antibody (3E6)

  • Fkh14
  • FKHL14LD
  • forkhead box C2 (MFH-1, mesenchyme forkhead 1)
  • forkhead, Drosophila, homolog-like 14
  • Forkhead-related protein FKHL14
  • FoxC2
  • LD
  • Mesenchyme fork head protein 1
  • mesenchyme forkhead 1
  • MFH-1 protein
  • MFH1
  • MFH-1
  • MFH1forkhead box protein C2
  • Transcription factor FKH-14

Background

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

664-LI/CF
Species: Hu
Applications: BA
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-79775
Species: Hu
Applications: IHC, IHC-P, PA, WB
NB300-581
Species: Am, Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP3-13106
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-85630
Species: Hu
Applications: IHC, IHC-P, WB
8184-CK
Species: Hu
Applications: EnzAct
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
202-IL
Species: Hu
Applications: BA
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
NB110-40877
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
D6050
Species: Hu
Applications: ELISA

Publications for FoxC2 Antibody (H00002303-M08) (0)

There are no publications for FoxC2 Antibody (H00002303-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxC2 Antibody (H00002303-M08) (0)

There are no reviews for FoxC2 Antibody (H00002303-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FoxC2 Antibody (H00002303-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FoxC2 Products

Bioinformatics Tool for FoxC2 Antibody (H00002303-M08)

Discover related pathways, diseases and genes to FoxC2 Antibody (H00002303-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxC2 Antibody (H00002303-M08)

Discover more about diseases related to FoxC2 Antibody (H00002303-M08).
 

Pathways for FoxC2 Antibody (H00002303-M08)

View related products by pathway.

PTMs for FoxC2 Antibody (H00002303-M08)

Learn more about PTMs related to FoxC2 Antibody (H00002303-M08).

Blogs on FoxC2.

The affects of Perilipin 2 on diet and metabolism
Perilipin 2 belongs to the Perilipin family, which consists of proteins that coat intracellular lipid storage droplets. Perilipin 2 in particular is involved in lipid globule surface membrane composition, and has also been implicated in the develo...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FoxC2 Antibody (3E6) and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXC2
Entrez
OMIM
Uniprot