FoxC2 Antibody (2H3)


Western Blot: FoxC2 Antibody (2H3) [H00002303-M02] - Western Blot analysis of FOXC2 expression in PC-12 ( Cat # L012V1 ).
Immunocytochemistry/ Immunofluorescence: FoxC2 Antibody (2H3) [H00002303-M02] - Analysis of monoclonal antibody to FOXC2 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: FoxC2 Antibody (2H3) [H00002303-M02] - Analysis of monoclonal antibody to FOXC2 on formalin-fixed paraffin-embedded human lateral ventricle wall. Antibody concentration 3 ug/ml.
Sandwich ELISA: FoxC2 Antibody (2H3) [H00002303-M02] - Detection limit for recombinant GST tagged FOXC2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P

Order Details

FoxC2 Antibody (2H3) Summary

FOXC2 (NP_005242.1 421 a.a. - 501 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY
FOXC2 (2H3)
IgG2b Lambda
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Read Publications using H00002303-M02.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
Protein A purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FoxC2 Antibody (2H3)

  • Fkh14
  • FKHL14LD
  • forkhead box C2 (MFH-1, mesenchyme forkhead 1)
  • forkhead, Drosophila, homolog-like 14
  • Forkhead-related protein FKHL14
  • FoxC2
  • LD
  • Mesenchyme fork head protein 1
  • mesenchyme forkhead 1
  • MFH-1 protein
  • MFH1
  • MFH-1
  • MFH1forkhead box protein C2
  • Transcription factor FKH-14


This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for FoxC2 Antibody (H00002303-M02)(4)

Reviews for FoxC2 Antibody (H00002303-M02) (0)

There are no reviews for FoxC2 Antibody (H00002303-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FoxC2 Antibody (H00002303-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FoxC2 Products

Bioinformatics Tool for FoxC2 Antibody (H00002303-M02)

Discover related pathways, diseases and genes to FoxC2 Antibody (H00002303-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxC2 Antibody (H00002303-M02)

Discover more about diseases related to FoxC2 Antibody (H00002303-M02).

Pathways for FoxC2 Antibody (H00002303-M02)

View related products by pathway.

PTMs for FoxC2 Antibody (H00002303-M02)

Learn more about PTMs related to FoxC2 Antibody (H00002303-M02).

Blogs on FoxC2.

The affects of Perilipin 2 on diet and metabolism
Perilipin 2 belongs to the Perilipin family, which consists of proteins that coat intracellular lipid storage droplets. Perilipin 2 in particular is involved in lipid globule surface membrane composition, and has also been implicated in the develo...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FoxC2 Antibody (2H3) and receive a gift card or discount.


Gene Symbol FOXC2