Western Blot: FoxC2 Antibody (2H3) [H00002303-M02] - Western Blot analysis of FOXC2 expression in PC-12 ( Cat # L012V1 ).
Immunocytochemistry/ Immunofluorescence: FoxC2 Antibody (2H3) [H00002303-M02] - Analysis of monoclonal antibody to FOXC2 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: FoxC2 Antibody (2H3) [H00002303-M02] - Immunoperoxidase of monoclonal antibody to FoxC2 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 ug/ml]
Immunohistochemistry-Paraffin: FoxC2 Antibody (2H3) [H00002303-M02] - Analysis of monoclonal antibody to FOXC2 on formalin-fixed paraffin-embedded human lateral ventricle wall. Antibody concentration 3 ug/ml.
Immunohistochemistry-Paraffin: FoxC2 Antibody (2H3) [H00002303-M02] - Immunoperoxidase of monoclonal antibody to FoxC2 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]
Sandwich ELISA: FoxC2 Antibody (2H3) [H00002303-M02] - Detection limit for recombinant GST tagged FOXC2 is approximately 0.3ng/ml as a capture antibody.
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
FOXC2 (NP_005242.1, 421 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY
Specificity
FOXC2 (2H3)
Isotype
IgG2b Lambda
Clonality
Monoclonal
Host
Mouse
Gene
FOXC2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for FoxC2 Antibody (2H3)
Fkh14
FKHL14LD
forkhead box C2 (MFH-1, mesenchyme forkhead 1)
forkhead, Drosophila, homolog-like 14
Forkhead-related protein FKHL14
FoxC2
LD
Mesenchyme fork head protein 1
mesenchyme forkhead 1
MFH-1 protein
MFH1
MFH-1
MFH1forkhead box protein C2
Transcription factor FKH-14
Background
This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Bioinformatics Tool for FoxC2 Antibody (H00002303-M02)
Discover related pathways, diseases and genes to FoxC2 Antibody (H00002303-M02). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for FoxC2 Antibody (H00002303-M02)
Discover more about diseases related to FoxC2 Antibody (H00002303-M02).
The affects of Perilipin 2 on diet and metabolism Perilipin 2 belongs to the Perilipin family, which consists of proteins that coat intracellular lipid storage droplets. Perilipin 2 in particular is involved in lipid globule surface membrane composition, and has also been implicated in the develo... Read full blog post.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our FoxC2 Antibody (2H3) and receive a gift card or discount.