FOXA3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FOXA3 Antibody [NBP2-55686] - Staining of human cell line Hep G2 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FOXA3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGP
Specificity
Specificity of human FOXA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOXA3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FOXA3 Recombinant Protein Antigen (NBP2-55686PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FOXA3 Antibody

  • FKHH3
  • Fork head-related protein FKH H3
  • forkhead box A3
  • Forkhead box protein A3
  • hepatocyte nuclear factor 3, gamma
  • hepatocyte nuclear factor 3-gamma
  • HNF-3G
  • HNF-3-gamma
  • HNF3GTCF-3G
  • MGC10179
  • TCF3G
  • Transcription factor 3G

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2400
Species: Hu
Applications: WB, ChIP, ICC
NBP2-45354
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP2-27079
Species: Hu, Ca, Pm
Applications: WB, IHC-P
NBP1-89679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
7270-IL/CF
Species: Hu
AF4186
Species: Hu
Applications: WB, ICC
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-52575
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-64688
Species: Hu

Publications for FOXA3 Antibody (NBP2-55686) (0)

There are no publications for FOXA3 Antibody (NBP2-55686).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXA3 Antibody (NBP2-55686) (0)

There are no reviews for FOXA3 Antibody (NBP2-55686). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FOXA3 Antibody (NBP2-55686) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for FOXA3 Antibody (NBP2-55686)

Discover related pathways, diseases and genes to FOXA3 Antibody (NBP2-55686). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOXA3 Antibody (NBP2-55686)

Discover more about diseases related to FOXA3 Antibody (NBP2-55686).
 

Pathways for FOXA3 Antibody (NBP2-55686)

View related products by pathway.

PTMs for FOXA3 Antibody (NBP2-55686)

Learn more about PTMs related to FOXA3 Antibody (NBP2-55686).
 

Research Areas for FOXA3 Antibody (NBP2-55686)

Find related products by research area.

Blogs on FOXA3

There are no specific blogs for FOXA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FOXA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXA3