FOXA3 Antibody

Images

 
Western Blot: FOXA3 Antibody [H00003171-B01P] - Analysis of FOXA3 expression in transfected 293T cell line by FOXA3 polyclonal antibody. Lane 1: FOXA3 transfected lysate(38.5 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FOXA3 Antibody Summary

Immunogen
FOXA3 (NP_004488.2, 1 a.a. - 350 a.a.) full-length human protein. MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FOXA3
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FOXA3 Antibody

  • FKHH3
  • Fork head-related protein FKH H3
  • forkhead box A3
  • Forkhead box protein A3
  • hepatocyte nuclear factor 3, gamma
  • hepatocyte nuclear factor 3-gamma
  • HNF-3G
  • HNF-3-gamma
  • HNF3GTCF-3G
  • MGC10179
  • TCF3G
  • Transcription factor 3G

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2400
Species: Hu
Applications: WB, ChIP, ICC
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP2-27079
Species: Hu, Ca, Pm
Applications: WB, IHC-P
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF4186
Species: Hu
Applications: WB, ICC
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-85699
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003171-B01P
Species: Hu
Applications: WB

Publications for FOXA3 Antibody (H00003171-B01P) (0)

There are no publications for FOXA3 Antibody (H00003171-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXA3 Antibody (H00003171-B01P) (0)

There are no reviews for FOXA3 Antibody (H00003171-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FOXA3 Antibody (H00003171-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FOXA3 Products

Bioinformatics Tool for FOXA3 Antibody (H00003171-B01P)

Discover related pathways, diseases and genes to FOXA3 Antibody (H00003171-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOXA3 Antibody (H00003171-B01P)

Discover more about diseases related to FOXA3 Antibody (H00003171-B01P).
 

Pathways for FOXA3 Antibody (H00003171-B01P)

View related products by pathway.

PTMs for FOXA3 Antibody (H00003171-B01P)

Learn more about PTMs related to FOXA3 Antibody (H00003171-B01P).
 

Research Areas for FOXA3 Antibody (H00003171-B01P)

Find related products by research area.

Blogs on FOXA3

There are no specific blogs for FOXA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FOXA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXA3
Uniprot