FOLR3 Antibody

Images

 
Western Blot: FOLR3 Antibody [H00002352-D01P] - Analysis of FOLR3 expression in transfected 293T cell line by FOLR3 polyclonal antibody.Lane 1: FOLR3 transfected lysate(26.95 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

FOLR3 Antibody Summary

Immunogen
FOLR3 (AAI48786.1, 1 a.a. - 245 a.a.) full-length human protein. MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS
Specificity
Reacts with folate receptor 3 (gamma).
Clonality
Polyclonal
Host
Rabbit
Gene
FOLR3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FOLR3 Antibody

  • folate receptor 3 (gamma)
  • Folate receptor 3
  • folate receptor gamma
  • FOLR3
  • FR-G
  • FR-gamma
  • gamma-hFR

Background

This gene encodes a member of the folate receptor (FOLR) family, members of which have a high affinity for folic acid and for several reduced folic acid derivatives, and mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This gene includes two polymorphic variants; the shorter one has two base deletion in the CDS, resulting in a truncated polypeptide, compared to the longer one. Both protein products are constitutively secreted in hematopoietic tissues and are potential serum marker for certain hematopoietic malignancies. The longer protein has a 71% and 79% sequence homology with the FOLR1 and FOLR2 proteins, respectively. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5646
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF5697
Species: Hu
Applications: WB, ICC
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP1-83435
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-52193
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-46201
Species: Hu
Applications: WB, IHC
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NB100-2590
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-132
Species: Hu, Mu, Rt, ChHa, Ha, Mk, Rb
Applications: WB, ICC/IF, IHC, IHC-P, In vitro
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP2-15564
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NB100-41371
Species: Hu, Mu, Rt, Ma
Applications: WB, IHC, IHC-P, PEP-ELISA
H00002352-D01P
Species: Hu
Applications: WB

Publications for FOLR3 Antibody (H00002352-D01P) (0)

There are no publications for FOLR3 Antibody (H00002352-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOLR3 Antibody (H00002352-D01P) (0)

There are no reviews for FOLR3 Antibody (H00002352-D01P). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FOLR3 Antibody (H00002352-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FOLR3 Antibody Products

Related Products by Gene

Bioinformatics Tool for FOLR3 Antibody (H00002352-D01P)

Discover related pathways, diseases and genes to FOLR3 Antibody (H00002352-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOLR3 Antibody (H00002352-D01P)

Discover more about diseases related to FOLR3 Antibody (H00002352-D01P).
 

Pathways for FOLR3 Antibody (H00002352-D01P)

View related products by pathway.

Blogs on FOLR3

There are no specific blogs for FOLR3, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our FOLR3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOLR3
Entrez
Uniprot

Customers Who Bought This Also Bought