Folliculin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Folliculin Antibody [NBP1-89983] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Folliculin Antibody [NBP1-89983] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Folliculin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VGCEDDQSLSKYEFVVTSGSPVAADRVGPTILNKIEAALTNQNLSVDVVDQCLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMTGLSKTYKSHLMSTVR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FLCN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Folliculin Protein (NBP1-89983PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Folliculin Antibody

  • BHD skin lesion fibrofolliculoma protein
  • BHDFLCL
  • Birt-Hogg-Dube syndrome protein
  • DKFZp547A118
  • FLJ45004
  • FLJ99377
  • folliculin
  • MGC17998
  • MGC23445

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-485
Species: Hu
Applications: WB, IP
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP2-46234
Species: Hu
Applications: WB, IHC
NBP2-49544
Species: Hu
Applications: IHC
NBP1-80841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83701
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93724
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NBP1-89983
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Folliculin Antibody (NBP1-89983) (0)

There are no publications for Folliculin Antibody (NBP1-89983).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Folliculin Antibody (NBP1-89983) (0)

There are no reviews for Folliculin Antibody (NBP1-89983). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Folliculin Antibody (NBP1-89983) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Folliculin Products

Bioinformatics Tool for Folliculin Antibody (NBP1-89983)

Discover related pathways, diseases and genes to Folliculin Antibody (NBP1-89983). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Folliculin Antibody (NBP1-89983)

Discover more about diseases related to Folliculin Antibody (NBP1-89983).
 

Pathways for Folliculin Antibody (NBP1-89983)

View related products by pathway.

PTMs for Folliculin Antibody (NBP1-89983)

Learn more about PTMs related to Folliculin Antibody (NBP1-89983).
 

Research Areas for Folliculin Antibody (NBP1-89983)

Find related products by research area.

Blogs on Folliculin

There are no specific blogs for Folliculin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Folliculin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FLCN