FMO5 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

FMO5 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FMO5.
  
  

  Source: E. coli

  Amino Acid Sequence: PLGAIMPISELQGRWATQVFKGLKTLPSQSEMMAEISKAQEEIDKRYVESQRHTIQGDYIDTMEELADLVGVRPNLLSLAFTDPKLALHLLLGPCTPIHYRVQGPGKWDGARKAILTTDD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: FMO5
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86093.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FMO5 Recombinant Protein Antigen

• dimethylaniline monooxygenase [N-oxide-forming] 5
• Dimethylaniline oxidase 5
• EC 1.14.13.8
• flavin containing monooxygenase 5
• FMO 5
• Hepatic flavin-containing monooxygenase 5

Background

FMO5, also known as Dimethylaniline monooxygenase [N-oxide-forming] 5, has a 533 amino acid long isoform that is 60 kDa and a short 285 amino acid isoform that is 32 kDa; is most often expressed in adult and fetal liver, and in contrast with other forms of FMO it does not seem to be a drug-metabolizing enzyme. This protein has been studied for its involvement in trimethylaminuria, hearing loss, hepatitis, and atrioventricular septal defect. FMO5 interacts with CYP3A5, CYP3A43, CYP2D6, CYP3A7, and CYP3A4 and it has been linked to Busulfan Q06828 (pharmacodynamics) and drug metabolism - cytochrome P450 pathways .

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: FMO5