We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

FMO1 Recombinant Protein Antigen

Images

 
There are currently no images for FMO1 Recombinant Protein Antigen (NBP3-17848PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FMO1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FMO1

Source: E. coli

Amino Acid Sequence: FPFPEDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVTKCSDSAVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FMO1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17848.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FMO1 Recombinant Protein Antigen

  • dimethylaniline monooxygenase [N-oxide-forming] 1
  • Dimethylaniline oxidase 1
  • EC 1.14.13.8
  • Fetal hepatic flavin-containing monooxygenase 1
  • flavin containing monooxygenase 1
  • Flavin-containing monooxygenase 1 (fetal liver)
  • FMO 1

Background

Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase andis subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidationcapacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenasesare NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs,pesticides, and xenobiotics. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33583
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-59353
Species: Hu
Applications: WB
NBP1-86093
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-33318
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-02563
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-91818
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-10546
Species: Hu
Applications: WB
NBP1-85367
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-01437
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC,  IHC-P, WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01800
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
NBP2-01397
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-88054
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-31329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-1607
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
NBP1-68885
Species: Hu
Applications: IHC, WB

Publications for FMO1 Recombinant Protein Antigen (NBP3-17848PEP) (0)

There are no publications for FMO1 Recombinant Protein Antigen (NBP3-17848PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FMO1 Recombinant Protein Antigen (NBP3-17848PEP) (0)

There are no reviews for FMO1 Recombinant Protein Antigen (NBP3-17848PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FMO1 Recombinant Protein Antigen (NBP3-17848PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FMO1 Products

Research Areas for FMO1 Recombinant Protein Antigen (NBP3-17848PEP)

Find related products by research area.

Blogs on FMO1

There are no specific blogs for FMO1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FMO1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FMO1