FMNL1 Antibody - BSA Free

Immunohistochemistry-Paraffin: FMNL1 Antibody [NBP1-88460] - Staining in human lymph node and liver tissues . Corresponding FMNL1 RNA-seq data are presented for the same tissues.

Western Blot: FMNL1 Antibody [NBP1-88460] - Analysis in human cell lines U-251MG and PC-3 using anti-FMNL1 antibody. Corresponding FMNL1 RNA-seq data are presented for the same cell lines. Loading control: anti-PARP1.

Immunocytochemistry/Immunofluorescence: FMNL1 Antibody [NBP1-88460] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: FMNL1 Antibody [NBP1-88460] - Staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.

Immunohistochemistry-Paraffin: FMNL1 Antibody [NBP1-88460] - Staining of human lung shows strong cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: FMNL1 Antibody [NBP1-88460] - Staining of human lymph node shows strong positivity.

Immunohistochemistry-Paraffin: FMNL1 Antibody [NBP1-88460] - Staining of human small intestine shows cytoplasmic positivity.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FMNL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FMNL1 Antibody - BSA Free (NBP1-88460) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-FMNL1 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LHYLVKVIAEKYPQLTGFHSDLHFLDKAGSVSLDSVLADVRSLQRGLELTQREFVRQDDCMVLKEFLRANSPTMDKLLADSKTAQEAFESVVEYFGENPKTTSPGLFFSLFS
• Predicted Species: Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FMNL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FMNL1 Protein (NBP1-88460PEP)

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 26457319)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FMNL1 Antibody - BSA Free

• C17orf1BMGC133052
• C17orf1KW-13
• CLL-associated antigen KW-13
• FHOD4
• FMNLMGC1894
• formin-like 1
• formin-like protein 1
• formin-like
• Leukocyte formin
• MGC21878

Background

The FMNL1 gene encodes a formin-related protein. Formin-related proteins have been implicated in morphogenesis, cytokinesis,and cell polarity. An alternative splice variant has been described but its full length sequence has not beendetermined. (provided by Re

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FMNL1 Antibody (NBP1-88460)(4)

Publications using NBP1-88460

• Wang X, Wang Z, Liu B et al. Characteristic gene expression in the liver monocyte-macrophage-DC system is associated with the progression of fibrosis in NASH Frontiers in Immunology 2023-02-24 [PMID: 36911682]
• Miller, EW;Blystone, SD; The carboxy-terminus of the formin FMNL1 gamma bundles actin to potentiate adenocarcinoma migration J. Cell. Biochem. 2019-04-11 [PMID: 30977161] (WB, Human)
• Miller MR, Blystone SD. Reliable and inexpensive expression of large, tagged, exogenous proteins in murine bone marrow-derived macrophages using a second generation lentiviral system. J Biol Methods 2015-01-01 [PMID: 26457319] (WB, Mouse)
• Gardberg M, Heuser VD, Iljin K et al. Characterization of Leukocyte Formin FMNL1 Expression in Human Tissues. J Histochem Cytochem 2014-04-03 [PMID: 24700756]

Bioinformatics

• Gene Symbol: FMNL1