FMNL1 Antibody

Images

 
Orthogonal Strategies: Western Blot: FMNL1 Antibody [NBP1-88460] - Analysis in human cell lines U-251MG and PC-3 using anti-FMNL1 antibody. Corresponding FMNL1 RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: FMNL1 Antibody [NBP1-88460] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Orthogonal Strategies: Immunohistochemistry-Paraffin: FMNL1 Antibody [NBP1-88460] - Staining in human lymph node and liver tissues. Corresponding FMNL1 RNA-seq data are presented for the same tissues.
Western Blot: FMNL1 Antibody [NBP1-88460] - Analysis in human cell line MOLT-4.
Immunohistochemistry-Paraffin: FMNL1 Antibody [NBP1-88460] - Staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.
Immunohistochemistry-Paraffin: FMNL1 Antibody [NBP1-88460] - Staining of human lung shows strong cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: FMNL1 Antibody [NBP1-88460] - Staining of human lymph node shows strong positivity.
Immunohistochemistry-Paraffin: FMNL1 Antibody [NBP1-88460] - Staining of human small intestine shows cytoplasmic positivity.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

FMNL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LHYLVKVIAEKYPQLTGFHSDLHFLDKAGSVSLDSVLADVRSLQRGLELTQREFVRQDDCMVLKEFLRANSPTMDKLLADSKTAQEAFESVVEYFGENPKTTSPGLFFSLFS
Specificity
Specificity of human FMNL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FMNL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FMNL1 Protein (NBP1-88460PEP)
Publications
Read Publications using
NBP1-88460 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24700756)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FMNL1 Antibody

  • C17orf1BMGC133052
  • C17orf1KW-13
  • CLL-associated antigen KW-13
  • FHOD4
  • FMNLMGC1894
  • formin-like 1
  • formin-like protein 1
  • formin-like
  • Leukocyte formin
  • MGC21878

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24748
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP2-24724
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB
NB600-231
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-24536
Species: Hu, Mu
Applications: WB
NBP2-24623
Species: Hu, Mu, Rt, Bv, Ca, Eq
Applications: WB
NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94174
Species: Hu
Applications: WB, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87933
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-83900
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24615
Species: Hu
Applications: WB, IHC-P
H00081624-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84718
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67632
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00025861-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-24526
Species: Hu, Mu, Rt
Applications: WB, IHC-P

Publications for FMNL1 Antibody (NBP1-88460)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for FMNL1 Antibody (NBP1-88460) (0)

There are no reviews for FMNL1 Antibody (NBP1-88460). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FMNL1 Antibody (NBP1-88460) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FMNL1 Products

Bioinformatics Tool for FMNL1 Antibody (NBP1-88460)

Discover related pathways, diseases and genes to FMNL1 Antibody (NBP1-88460). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FMNL1 Antibody (NBP1-88460)

Discover more about diseases related to FMNL1 Antibody (NBP1-88460).
 

Pathways for FMNL1 Antibody (NBP1-88460)

View related products by pathway.

PTMs for FMNL1 Antibody (NBP1-88460)

Learn more about PTMs related to FMNL1 Antibody (NBP1-88460).

Blogs on FMNL1

There are no specific blogs for FMNL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FMNL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FMNL1