Flt-3 Ligand Antibody Summary
| Immunogen |
Synthetic peptides corresponding to FLT3LG(fms-related tyrosine kinase 3 ligand) The peptide sequence was selected form the N terminal of FLT3LG. Peptide sequence TVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDY. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FLT3LG |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against FLT3LG and was validated on Western blot. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Purity |
Immunogen affinity purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Flt-3 Ligand Antibody
Background
FLT3LG stimulates the proliferation of early hematopoietic cells and synergizes well with a number of other colony stimulating factors and interleukins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Po
Applications: Flow, IHC-Fr, IF
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Bv, Ca, Sh
Applications: WB
Publications for Flt-3 Ligand Antibody (NBP1-62304) (0)
There are no publications for Flt-3 Ligand Antibody (NBP1-62304).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Flt-3 Ligand Antibody (NBP1-62304) (0)
There are no reviews for Flt-3 Ligand Antibody (NBP1-62304).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Flt-3 Ligand Antibody (NBP1-62304) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional Flt-3 Ligand Products
Bioinformatics Tool for Flt-3 Ligand Antibody (NBP1-62304)
Discover related pathways, diseases and genes to Flt-3 Ligand Antibody (NBP1-62304). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Flt-3 Ligand Antibody (NBP1-62304)
Discover more about diseases related to Flt-3 Ligand Antibody (NBP1-62304).
| | Pathways for Flt-3 Ligand Antibody (NBP1-62304)
View related products by pathway.
|
PTMs for Flt-3 Ligand Antibody (NBP1-62304)
Learn more about PTMs related to Flt-3 Ligand Antibody (NBP1-62304).
| | Research Areas for Flt-3 Ligand Antibody (NBP1-62304)
Find related products by research area.
|
Blogs on Flt-3 Ligand