FLRT1 Antibody

Images

 
Immunohistochemistry: FLRT1 Antibody [NBP2-49139] - Staining of human hippocampus shows moderate positivity in neuropil.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FLRT1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAK
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FLRT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FLRT1 Recombinant Protein Antigen (NBP2-49139PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FLRT1 Antibody

  • fibronectin leucine rich transmembrane protein 1
  • Fibronectin-like domain-containing leucine-rich transmembrane protein 1
  • FLRT1
  • leucine-rich repeat transmembrane protein FLRT1
  • MGC21624
  • SPG68

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF2877
Species: Hu
Applications: WB
AF2795
Species: Hu
Applications: WB
NB600-1287
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
MAB6896
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
1109-N1/CF
Species: Mu
Applications: Bind
AF1429
Species: Hu
Applications: WB
NBP2-00932
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
7754-BH/CF
Species: Hu
Applications: BA
NBP3-15868
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1006
Species: Rt
Applications: IHC, WB
233-FB/CF
Species: Hu
Applications: BA
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
3218-ND/CF
Species: Hu
Applications: BA
AF4990
Species: Hu, Mu
Applications: IHC, WB

Publications for FLRT1 Antibody (NBP2-49139) (0)

There are no publications for FLRT1 Antibody (NBP2-49139).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLRT1 Antibody (NBP2-49139) (0)

There are no reviews for FLRT1 Antibody (NBP2-49139). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FLRT1 Antibody (NBP2-49139) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FLRT1 Products

Bioinformatics Tool for FLRT1 Antibody (NBP2-49139)

Discover related pathways, diseases and genes to FLRT1 Antibody (NBP2-49139). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FLRT1 Antibody (NBP2-49139)

Discover more about diseases related to FLRT1 Antibody (NBP2-49139).
 

Pathways for FLRT1 Antibody (NBP2-49139)

View related products by pathway.

PTMs for FLRT1 Antibody (NBP2-49139)

Learn more about PTMs related to FLRT1 Antibody (NBP2-49139).
 

Research Areas for FLRT1 Antibody (NBP2-49139)

Find related products by research area.

Blogs on FLRT1

There are no specific blogs for FLRT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FLRT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FLRT1