FLIP Antibody (2F12)

Images

 
Western Blot: FLIP Antibody (2F12) [H00008837-M01] - CFLAR monoclonal antibody (M01), clone 2F12. Analysis of CFLAR expression in K-562.
Immunocytochemistry/ Immunofluorescence: FLIP Antibody (2F12) [H00008837-M01] - Analysis of monoclonal antibody to CFLAR on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: FLIP Antibody (2F12) [H00008837-M01] - Analysis of monoclonal antibody to CFLAR on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Western Blot: FLIP Antibody (2F12) [H00008837-M01] - Western blot of FLIP provided courtesty of verified customer.
Western Blot: FLIP Antibody (2F12) [H00008837-M01] - CFLAR monoclonal antibody (M01), clone 2F12 Analysis of CFLAR expression in IMR-32.
Western Blot: FLIP Antibody (2F12) [H00008837-M01] - Analysis of CFLAR expression in transfected 293T cell line by CFLAR monoclonal antibody (M01), clone 2F12.Lane 1: CFLAR transfected lysate (Predicted MW: 55.3 ...read more
Sandwich ELISA: FLIP Antibody (2F12) [H00008837-M01] - Detection limit for recombinant GST tagged CFLAR is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
2F12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FLIP Antibody (2F12) Summary

Immunogen
CFLAR (AAH01602, 178 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYE
Specificity
CFLAR - CASP8 and FADD-like apoptosis regulator
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CFLAR
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Reviewed Applications
Read 1 Review rated 5
using
H00008837-M01 in the following applications:

Publications
Read Publication using
H00008837-M01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FLIP Antibody (2F12)

  • CASHFADD-like antiapoptotic molecule 1
  • CASP8 and FADD-like apoptosis regulator
  • CASP8AP1
  • Caspase homolog
  • Caspase-eight-related protein
  • Caspase-like apoptosis regulatory protein
  • caspase-related inducer of apoptosis
  • CASPER
  • CasperFLAME1
  • Cellular FLICE-like inhibitory protein
  • CFLAR
  • c-FLIPR
  • c-FLIPS
  • CLARPMACH-related inducer of toxicity
  • FADD-like apoptotic molecule
  • FLAME
  • FLAME-1
  • FLIP
  • I-FLICE
  • I-FLICEMRITc-FLIPFLIPc-FLIPL
  • Inhibitor of FLICE
  • usurpin beta
  • Usurpin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56116
Species: Hu, Mu, Rt, Ma
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
NB100-56104
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56118
Species: Hu, Mu, Rt, Ca, Ma
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56618
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-CS
MAB7047
Species: Hu
Applications: WB, ICC
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NB100-56183
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF860
Species: Hu, Mu
Applications: WB, Simple Western, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow

Publications for FLIP Antibody (H00008837-M01)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for FLIP Antibody (H00008837-M01) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using H00008837-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot FLIP H00008837-M01
Enlarge
5
reviewed by:
Kishu Ranjan
WB Mouse 01/31/2014
View

Summary

ApplicationWestern Blot
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FLIP Antibody (H00008837-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FLIP Products

Bioinformatics Tool for FLIP Antibody (H00008837-M01)

Discover related pathways, diseases and genes to FLIP Antibody (H00008837-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FLIP Antibody (H00008837-M01)

Discover more about diseases related to FLIP Antibody (H00008837-M01).
 

Pathways for FLIP Antibody (H00008837-M01)

View related products by pathway.

PTMs for FLIP Antibody (H00008837-M01)

Learn more about PTMs related to FLIP Antibody (H00008837-M01).
 

Research Areas for FLIP Antibody (H00008837-M01)

Find related products by research area.

Blogs on FLIP.

TRAIL-R2: The Trail Less Traveled
Cells undergo apoptotic programmed cell death in response to various stimuli, and this key mechanism is necessary for cellular morphogenesis, tissue homeostasis, and host defense. Particular cytokines such as tumor necrosis factor (TNF) and the Fas li...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Kishu Ranjan
01/31/2014
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol CFLAR
Entrez
OMIM
Uniprot