Recombinant Human Flavin containing monooxygenase 4 Protein

Images

 
SDS-Page: Recombinant Human Flavin containing monooxygenase 4 Protein [H00002329-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Flavin containing monooxygenase 4 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 206-301 of Human Flavin containing monooxygenase 4

Source: Wheat Germ

Amino Acid Sequence: TAAQVLLSTRTGTWVLGRSSDWGYPYNMMVTRRCCSFIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAKFIVNDELPNCILCGAITMKTS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FMO4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Flavin containing monooxygenase 4 Protein

  • dimethylaniline monooxygenase [N-oxide-forming] 4
  • Dimethylaniline oxidase 4
  • EC 1.14.13.8
  • flavin containing monooxygenase 4
  • FMO 4
  • FMO2
  • Hepatic flavin-containing monooxygenase 4

Background

Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86412
Species: Hu
Applications: IHC, IHC-P
NBP1-33583
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-56713
Species: Hu
Applications: WB, ICC/IF
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00001549-P01
Species: Hu
H00002329-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for Flavin containing monooxygenase 4 Partial Recombinant Protein (H00002329-Q01) (0)

There are no publications for Flavin containing monooxygenase 4 Partial Recombinant Protein (H00002329-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Flavin containing monooxygenase 4 Partial Recombinant Protein (H00002329-Q01) (0)

There are no reviews for Flavin containing monooxygenase 4 Partial Recombinant Protein (H00002329-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Flavin containing monooxygenase 4 Partial Recombinant Protein (H00002329-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Flavin containing monooxygenase 4 Partial Recombinant Protein (H00002329-Q01)

Discover related pathways, diseases and genes to Flavin containing monooxygenase 4 Partial Recombinant Protein (H00002329-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Flavin containing monooxygenase 4 Partial Recombinant Protein (H00002329-Q01)

Discover more about diseases related to Flavin containing monooxygenase 4 Partial Recombinant Protein (H00002329-Q01).
 

Pathways for Flavin containing monooxygenase 4 Partial Recombinant Protein (H00002329-Q01)

View related products by pathway.

PTMs for Flavin containing monooxygenase 4 Partial Recombinant Protein (H00002329-Q01)

Learn more about PTMs related to Flavin containing monooxygenase 4 Partial Recombinant Protein (H00002329-Q01).

Blogs on Flavin containing monooxygenase 4

There are no specific blogs for Flavin containing monooxygenase 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Flavin containing monooxygenase 4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FMO4