Recombinant Human Flavin containing monooxygenase 4 Protein

SDS-Page: Recombinant Human Flavin containing monooxygenase 4 Protein [H00002329-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, PA, PAGE, AP

Recombinant Human Flavin containing monooxygenase 4 Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 206-301 of Human Flavin containing monooxygenase 4
  
  

  Source: Wheat Germ

  Amino Acid Sequence: TAAQVLLSTRTGTWVLGRSSDWGYPYNMMVTRRCCSFIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAKFIVNDELPNCILCGAITMKTS

• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: FMO4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Theoretical MW: 36.3 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Flavin containing monooxygenase 4 Protein

• dimethylaniline monooxygenase [N-oxide-forming] 4
• Dimethylaniline oxidase 4
• EC 1.14.13.8
• flavin containing monooxygenase 4
• FMO 4
• FMO2
• Hepatic flavin-containing monooxygenase 4

Background

Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: FMO4